KEGG   Haemophilus parasuis SH0165: HAPS_2188Help
Entry
HAPS_2188         CDS       T00825                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAPS_2188 (pfkA)
   01230 Biosynthesis of amino acids
    HAPS_2188 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAPS_2188 (pfkA)
   00030 Pentose phosphate pathway
    HAPS_2188 (pfkA)
   00051 Fructose and mannose metabolism
    HAPS_2188 (pfkA)
   00052 Galactose metabolism
    HAPS_2188 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HAPS_2188 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HAPS_2188 (pfkA)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HAPS_2188 (pfkA)
Protein phosphatases and associated proteins [BR:hap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HAPS_2188 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2153323..2154288)
Genome map
AA seq 321 aa AA seqDB search
MVKKIAVLTSGGDAPGMNAAIRGVVRAGLSEGLEVYGIQDGYYGLYHDRVIKLERRSVSE
VINRGGTFLGSARFPEFKNPEVRAKCVETLKKYEIDALVVIGGDGSYMGAKLLTEEHGIA
CIGLPGTIDNDVAGTDYTIGFQTALETALEAIDRLRDTSTSHQRISIVEIMGRHCGDLTL
SAALAGGCEYIIIPEKGFDKESLIRNIEDGFNKGKRHAIIAITELMTDVHQLAREIEERF
GHETRAAVLGHTQRGGAPCAFDRILASRMGVYAVELLMQGYGGRCVGIQNEKLVHHDIID
AITNMRRPFKEEIFNTSRKLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaaattgcagtattaaccagtggcggtgatgctcctggtatgaatgcagcg
atccgtggtgttgtgcgtgcgggtttaagtgaaggtttagaagtatatggtattcaagac
ggttattacggtttatatcacgaccgtgttatcaaacttgaacgccgttcagtgtctgag
gtgatcaaccgtggtggtacattcttaggttctgcacgtttccctgaatttaaaaatcca
gaagtgcgtgcaaaatgtgtagaaaccttgaaaaaatatgaaattgatgcgttagtagtt
atcggcggtgacggctcttatatgggggcaaaactattgaccgaagaacacggcattgcg
tgtatcggtctacctggcactattgataatgacgttgcaggcacggattacactatcggt
ttccaaacagcacttgaaaccgcattagaagcaattgaccgcttgcgtgatacttcaact
tctcaccaacgcatttctatcgttgaaattatggggcgccactgtggtgatttaacctta
agtgcggcattagcaggcggttgtgaatacattatcattccagaaaaaggttttgataaa
gagtcactaatacgcaacatcgaagatggtttcaataaaggaaaacgtcacgcaattatt
gcgattacagaattaatgacagatgtacaccaattagcgagagagattgaagaacgcttt
ggccacgaaacccgtgctgctgtgttaggccatacccaacgtggtggtgcgccttgtgca
tttgaccgtattttagcttctcgtatgggcgtttatgcagtagaactcttgatgcaaggc
tacggtggtcgttgtgtgggtattcaaaatgaaaaattagttcaccacgatattattgat
gcaatcactaatatgcgtcgtccgtttaaagaagaaatctttaatacctctagaaaatta
ttctaa

DBGET integrated database retrieval system