KEGG   Herminiimonas arsenicoxydans: HEAR0089Help
Entry
HEAR0089          CDS       T00490                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HEAR0089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR0089
  Lipid metabolism
   00071 Fatty acid degradation
    HEAR0089
  Amino acid metabolism
   00350 Tyrosine metabolism
    HEAR0089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HEAR0089
   00626 Naphthalene degradation
    HEAR0089
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HEAR0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82899..84137
Genome map
AA seq 412 aa AA seqDB search
MRSNDQIHFCPPARVVLGCGTRSQLPALLARLGYRSGVFITDTFFSEKTPWVREYIEAAE
ALGITTIVFDGGKADPTTTLCDDATALIRAQIGAVQPDHVIALGGGSNIDLAKALCVTIP
DGKPVAEFIGVLPNAPKALPLIALPTTAGTGSEATPGAILIDPSNATKVAVMDNVLRPVI
ALIDPEYTYTCPPRVTADSGVDALTHAVESYLTLDSAEFDRGGQVDPGYSGRSSLTMMFA
HEAIDLCARYLVRTYDDGSDTEARIGMAYASHYAALSYGGAGLNAVHGIAYAVAGITHET
HGSTNAVMLPYVLDAMRSVRHDELLKVARLFGIKDGDEARAVKELPVVIRELIGHLGIPT
TLATFGIAREQLPGMVADALAVTRLAKAFPVADVPAAYASIIERAWLGQLGD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaatgatcagatccatttttgtccgccggctcgcgtcgtactgggttgcggc
acgcgttcccagttgccggcgttgctggcgcgtctcggttatcgctcgggtgtattcatc
accgatacattcttcagcgaaaaaaccccgtgggtgcgcgaatacatcgaagctgcggaa
gcgctcggcattaccaccatcgtattcgacggcggcaaggccgatccgaccaccaccttg
tgcgatgacgcaaccgcattgatacgcgcacaaatcggcgcggtgcaaccggatcacgtg
atcgctttgggcggcggcagcaatatcgatttggcgaaggccttgtgcgtcaccattccg
gatggcaaaccggtagccgaatttatcggcgtcttgccaaatgcaccgaaagccttgccg
ctgattgccttgccgacgactgccggtaccggttcggaagcgacgccgggtgcgatcctg
atcgatccgagcaatgccaccaaggtcgcggtaatggacaacgtgttgcgtccggtgatt
gccttgatcgaccccgaatacacttacacgtgcccgccgcgcgtgaccgccgattccggc
gtcgatgcattgacgcatgcggtggagtcgtatctgacgctggactcggccgagttcgat
cgcggcggtcaggtcgatcctggctacagcggacgctcatcgctgacgatgatgtttgcg
catgaagcgatcgatttgtgcgcgcgctatctggtgcgcacctatgacgacggcagcgat
accgaagcgcgtatcggcatggcgtacgccagccactacgcggccctgtcgtatggcggt
gccggcctgaatgcagtgcacggcattgcctatgcagtagccggtatcacgcacgaaacc
cacggcagcaccaatgcagtgatgttgccgtatgtgctggatgcgatgcgctcggtgcgt
catgacgagctgctgaaagtggcgcgcctgttcggcatcaaggatggcgatgaagcgcgt
gcggtcaaggaattaccggttgttatccgtgagctgatcgggcacctgggtattccgacc
acgctcgcaacgttcggtatcgcgcgcgaacaattgccgggcatggtcgccgatgcgctg
gctgtcacacgcctggccaaggcattcccggtagcggacgtgccggctgcgtatgccagc
attattgagcgcgcctggttgggacagctgggcgattga

DBGET integrated database retrieval system