KEGG   Herminiimonas arsenicoxydans: HEAR0195Help
Entry
HEAR0195          CDS       T00490                                 

Definition
thioredoxin-like or protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HEAR0195
Secretion system [BR:har02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HEAR0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191209..191928
Genome map
AA seq 239 aa AA seqDB search
MNIFKAAIAVVLGLTFTAAFAETAQEAAVRKAIEPRLGSDAKVASVTKTPYSGLFEVQVN
GDIIYTDVKAQYLFVGRVVDTKTYQDYTKARLDELNQVAFSDLPLEAAMKQVKGNGKRVI
AVFEDPNCGYCKQFRKTLEGINDITVYTFMYNILSPDSITKSRNVWCSANRNKAWDDWML
NGKAPASASDNCVTPHEKVLALGRSMKVTGTPTIIFTDGSRVPGAIDAKALEAKLLSLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattcaaggctgcaattgcagtagtgctgggtttgacttttaccgctgcattt
gcagaaaccgcgcaggaagcggcagtaagaaaggcgattgagccgcgtttgggcagtgat
gccaaagtggcatcggtaaccaaaacgccgtattccggcttgtttgaagtgcaggtgaat
ggtgacattatctacaccgatgtaaaagcccagtatttattcgtcggtcgtgtggtcgat
accaaaacgtatcaggattacaccaaggcgcgtctggatgagctcaatcaggttgcattc
agcgacttgccgctggaagccgcgatgaaacaggtcaagggcaatggcaagcgcgtgatc
gccgtgtttgaagatcccaactgcggctattgcaaacaattccgtaagacgctggaaggc
atcaacgacatcactgtctacaccttcatgtacaacatcctgtcgccggactcgattacc
aaatcgcgcaatgtctggtgttctgcgaaccgcaacaaagcctgggacgactggatgctg
aacggcaaggcgccggcaagcgcctcggacaactgcgttacgccgcatgaaaaagtactg
gcgctcggacgcagcatgaaagtaaccggcacgccgaccatcattttcaccgacggttct
cgtgtaccgggcgcaatcgatgcgaaggcgctggaagcaaaactgctttctctcaaataa

DBGET integrated database retrieval system