KEGG   Herminiimonas arsenicoxydans: HEAR0207Help
Entry
HEAR0207          CDS       T00490                                 

Gene name
ECHS1
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HEAR0207 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HEAR0207 (ECHS1)
   00650 Butanoate metabolism
    HEAR0207 (ECHS1)
  Lipid metabolism
   00071 Fatty acid degradation
    HEAR0207 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HEAR0207 (ECHS1)
   00310 Lysine degradation
    HEAR0207 (ECHS1)
   00360 Phenylalanine metabolism
    HEAR0207 (ECHS1)
   00380 Tryptophan metabolism
    HEAR0207 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HEAR0207 (ECHS1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HEAR0207 (ECHS1)
   00281 Geraniol degradation
    HEAR0207 (ECHS1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HEAR0207 (ECHS1)
   00627 Aminobenzoate degradation
    HEAR0207 (ECHS1)
   00930 Caprolactam degradation
    HEAR0207 (ECHS1)
Enzymes [BR:har01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HEAR0207 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201506..202282
Genome map
AA seq 258 aa AA seqDB search
MQYENILIEIHGKVGLITLNRPAALNALNDKLMDELGKALLSFDANEDIGCMIITGSEKA
FAAGADIGAMATYSYMDVYKGDYITRNWEQIRSVRKPVIAAVAGYALGGGCELAMMCDFI
IAADTAKFGQPEIKLGIIPGAGGTQRLPRSVSKSKAMDMCLTARMMDAAEAERAGLVSRV
VAADKLQEEALAAATVIASMSLPMVMMIKESINRAYETTLAEGVQFERRLFHSTFATEDQ
KEGMRAFVEKRAAKFKNV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgaaaacatcctgatcgaaattcacggcaaggtcgggctcatcactcttaac
cggccggcggcattgaatgcgctcaatgacaaattgatggatgagctgggaaaggccctg
ctgtcgtttgacgccaatgaagatataggttgcatgatcattactggtagcgagaaagct
tttgccgccggcgccgatatcggcgcaatggcgacctactcatatatggatgtatataag
ggcgattacattacgcgcaactgggagcaaatccgcagcgtgcgcaaaccggtcatcgca
gcggtggcaggttatgcgctcggtggtggctgcgaattggcaatgatgtgcgacttcatt
attgcagcggatacggccaagttcggccagcctgaaatcaagctcggcattattccaggc
gcgggtggtacgcagcgcttgccgcgatctgtttcaaaatccaaggcgatggatatgtgc
ctgaccgcgcgcatgatggatgcagccgaagccgagcgcgccggtttggtatcgcgcgta
gtggcggcggacaagttgcaggaagaagcattggctgcggcaaccgtcattgccagcatg
tcgctgcctatggtcatgatgatcaaggaatccatcaatcgggcttatgaaacaacgctg
gccgaaggcgtgcagttcgaacgcaggctctttcacagcaccttcgcaacagaagatcag
aaagagggaatgagagcatttgtcgagaagcgcgcagctaaattcaagaatgtttga

DBGET integrated database retrieval system