KEGG   Herminiimonas arsenicoxydans: HEAR0257Help
Entry
HEAR0257          CDS       T00490                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:har00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HEAR0257 (ruvA)
Enzymes [BR:har01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HEAR0257 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249963..250448
Genome map
AA seq 161 aa AA seqDB search
MSTFYNLPGLGEKVALLTHLTVREDAHILFGFGTAEERNVFKQLVKITGIGARTALSILS
GMSVADLSNAITLQEAGRLTKIPGIGKKTAERLLLELKGKLGADLGAAGGVIHSDATSDI
LNALLALGYSDKEALLAMKQVPAGTGVSDGIKLALKALSKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttctacaatctgcccggcctgggtgaaaaagtcgccctgctgacgcatctg
acggtgcgcgaagatgcgcacattctgttcggcttcggcactgcggaagaacgcaatgtg
ttcaagcagctggtcaagatcaccggcataggcgcacgcactgccttgtcgattttgtcc
ggcatgtcggtagccgatttgtcgaatgccattaccttgcaggaagccgggcgcctgacc
aagattcccggcataggcaaaaaaactgccgaacgtctgctgctggaactgaaaggcaaa
ctcggcgccgatctgggcgctgccggcggtgtcatccacagcgatgccacatccgatatt
ctgaatgcactgctggcgctgggttactccgacaaggaagcgctgctggcgatgaagcag
gtgccggctggtaccggggtttccgacggcatcaagctggcgctgaaggcattgtcgaaa
gcctga

DBGET integrated database retrieval system