KEGG   Herminiimonas arsenicoxydans: HEAR0257Help
Entry
HEAR0257          CDS       T00490                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:har03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249963..250448
Genome map
AA seq 161 aa AA seqDB search
MSTFYNLPGLGEKVALLTHLTVREDAHILFGFGTAEERNVFKQLVKITGIGARTALSILS
GMSVADLSNAITLQEAGRLTKIPGIGKKTAERLLLELKGKLGADLGAAGGVIHSDATSDI
LNALLALGYSDKEALLAMKQVPAGTGVSDGIKLALKALSKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttctacaatctgcccggcctgggtgaaaaagtcgccctgctgacgcatctg
acggtgcgcgaagatgcgcacattctgttcggcttcggcactgcggaagaacgcaatgtg
ttcaagcagctggtcaagatcaccggcataggcgcacgcactgccttgtcgattttgtcc
ggcatgtcggtagccgatttgtcgaatgccattaccttgcaggaagccgggcgcctgacc
aagattcccggcataggcaaaaaaactgccgaacgtctgctgctggaactgaaaggcaaa
ctcggcgccgatctgggcgctgccggcggtgtcatccacagcgatgccacatccgatatt
ctgaatgcactgctggcgctgggttactccgacaaggaagcgctgctggcgatgaagcag
gtgccggctggtaccggggtttccgacggcatcaagctggcgctgaaggcattgtcgaaa
gcctga

DBGET integrated database retrieval system