KEGG   Herminiimonas arsenicoxydans: HEAR0287Help
Entry
HEAR0287          CDS       T00490                                 

Gene name
Hyr1
Definition
peroxiredoxin HYR1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HEAR0287 (Hyr1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HEAR0287 (Hyr1)
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HEAR0287 (Hyr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(281744..282235)
Genome map
AA seq 163 aa AA seqDB search
MNTQTVYDFSSHSLSGAAVDLAQYRGKVLLIVNTASKCGFTPQYEGLEAVYRQFRERGVE
VLGFPCNQFGGQEPGDAAAIGTFCEKNYGVTFPLFAKIDVNGDNADPLYQYLKHAAPGLL
GSEAIKWNFTKFLIRKNGTVYKRYAPQTKPEELIEDINTLLAE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacagaccgtttacgatttcagcagccacagtctgagcggcgcggctgtcgac
ctcgcacaatatcgcggcaaggtcttgttgatcgtcaataccgccagcaaatgcggcttc
acgccgcagtacgaaggactggaagctgtgtatagacaattccgcgagcgcggcgtggaa
gtgcttggcttcccctgcaatcagttcggcggacaggaaccgggcgacgcagccgccatc
gggacattctgcgaaaaaaattacggcgtgacatttccgctcttcgccaagatcgatgtg
aatggcgacaatgcggatccgctttatcaatacctgaaacacgctgcgcccggcctgctc
ggcagcgaagcaatcaaatggaatttcacaaaattcctgatcagaaaaaacggcaccgtc
tacaagcgctatgcgccgcaaaccaaaccggaagaactgatcgaggatatcaacacactg
ctcgccgaataa

DBGET integrated database retrieval system