KEGG   Herminiimonas arsenicoxydans: HEAR0375Help
Entry
HEAR0375          CDS       T00490                                 

Gene name
glyS
Definition
glycine tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:har00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(372751..374877)
Genome map
AA seq 708 aa AA seqDB search
MSNSVTIGMDTKNLLIELFVEELPPKALKKIGDAFAQLLQASLKTQGLLSTDSVLTQFAS
PRRLGVHLTQVAEQADDKQVMQKLMPASVGLTADGKATPALLKKLSALGANESAVAGLKR
ESDGKAEVLFFNSIVTGVTLADGLQKALEETLAKLPIPKVMGYQLADGWETVNFVRPAHG
LVALHGADVINVSALGLTAGNTTRGHRFEAGLDPVYIRDADSYAKQIATEGAVIASFAER
RAEIVRQLAAAASEAGDNLTPIEDEDLLDEVTGLVERPNVLIGQFEETFLAVPQECLILT
MKANQKYFPLLDSKGNLSNKFLIVSNIRPADASLVIGGNERVVRPRLADAKFFFDQDRKK
TLASRVAGLDKVVYHNKLGTQGERIARVRAIAQAIAAKLGIDVQQADTAAQLAKADLLTD
MVGEFPELQGIMGRYYALHDGLAENVADAIEDHYKPRFAGDTLPRNPVGMVVALADKLET
LVGLFSIGQIPTGDKDPFALRRHALGVIRMLIEGKLDIGINELIAAAEQPFNKLAIEHRD
ALITFIFDRLANALREQGYSAQEIDAVLALQPQKLADVASRLAAVRAFAVLPEAPALAAA
NKRVGNILKKVEGEVTAKVDPALLKEAAEIALNQTLTTVKPQADTAFARGDYAASLQVLA
ALKTPVDAFFESVMVNADDAALRNNRLGLLATLHHAMNQVADISKLAA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagcgtaactatcggcatggataccaaaaatttattaatcgaactgttcgtc
gaagaacttccgcccaaggcattgaaaaaaatcggcgatgcttttgcacagcttttgcag
gcatcgctgaaaacgcaaggtctgttatcaacagacagcgtgctgacgcaatttgcctcg
ccgcgccggctcggcgtgcacctgacgcaagttgccgaacaagccgatgacaagcaggtc
atgcaaaaactcatgccggccagcgtcggcttgacggcagatggcaaggccacaccggca
ttattgaaaaaactttccgctctgggtgcaaacgaatctgcagtcgccggcttgaaacgc
gaatccgacggcaaggccgaagtattgtttttcaacagcatcgtcaccggcgtcacactg
gccgacggcttgcaaaaagcgctggaagaaacactggcaaaattacccatcccaaaagtc
atgggctatcaattggccgatggctgggaaaccgtcaacttcgtgcgccctgcgcatggc
ctggtggcactgcacggtgccgatgtcatcaacgtttcagcactcggtctcaccgccggt
aatacaacccgcggccatcgctttgaagcaggactcgatccggtttacatccgcgacgcg
gacagctatgcaaaacaaatcgcgaccgaaggcgccgtcatcgccagcttcgccgaacgc
cgtgcagaaatcgtgcgccagctcgctgcagccgcaagcgaagccggcgacaatctgacg
ccgattgaagatgaagacttgctggatgaagtaaccggcctggtcgaacgtccgaatgta
ttgataggccagtttgaagaaaccttcctcgccgtaccgcaggaatgtctgatcctgacg
atgaaggccaatcagaaatattttcctctgctcgacagcaagggcaatctgagcaacaag
tttttgatcgtgtccaatattcgtccggccgatgccagcctcgtcatcggcggcaacgag
cgcgtcgtacgtccgcgtctggccgacgccaaattcttcttcgaccaggatcgcaagaaa
accctggcttcgcgtgtcgccggtctggataaagtcgtttatcacaacaagctcggtact
cagggcgagcgtattgcacgcgtgcgcgccattgcacaagccatcgcagccaaactcggt
atcgatgtacaacaagccgataccgcagcacaactggccaaggctgatctgctgaccgat
atggtcggcgaatttccggaactgcaaggcatcatgggacgttactacgccttgcacgac
ggcctggcagagaatgtggcggatgcgattgaagatcactataaaccgcgcttcgccggc
gatacgctgccgcgcaatccggtcggcatggtggtcgcactggccgacaaactggaaacg
ctggtcggcctgttcagcatcgggcagatcccgactggcgacaaggatccgtttgccttg
cgtcgccatgcgctgggcgtgattcgcatgctgatcgaaggcaagctcgatatcggcatc
aatgaattgatcgcagcggcagaacagccattcaacaagctggcgatcgaacatcgcgat
gcgctgatcaccttcattttcgatcgtcttgccaatgcgctgcgcgaacaaggctacagc
gcgcaagagatcgatgcagtactcgccttgcaaccgcaaaaactggctgatgttgccagc
cgtctggccgcagtgcgcgccttcgccgtcctgccggaagcaccggcgctggccgcagcg
aacaagcgggtcggcaatatactgaaaaaagtcgagggcgaagtgacggcgaaagtcgat
cccgcgctgctgaaggaagcagcagaaatcgccttgaatcaaacgctgacaacagtcaag
ccgcaagccgataccgcatttgcgcgtggcgactatgcggcctccctgcaggtattggcg
gcattgaaaacgccggtcgatgctttctttgaaagcgtgatggtaaatgccgacgatgcg
gcattgcgcaacaatcggctgggcttgctggcgaccttgcaccatgcgatgaatcaggtc
gccgatatttccaagctggctgcctaa

DBGET integrated database retrieval system