KEGG   Herminiimonas arsenicoxydans: HEAR0823Help
Entry
HEAR0823          CDS       T00490                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
har  Herminiimonas arsenicoxydans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HEAR0823
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HEAR0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828789..829157)
Genome map
AA seq 122 aa AA seqDB search
MQKKLLLALALSCAGYQAHAAGDVIAGKAAFAKCASCHQVGRSARGVFGPQLNGIVGRPA
GATKDFKYSAAMMNSRIVWSEASLRAFLKSPNDVVPENKMRFFGIGNDRQIDDLLAYLSQ
YK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagaaactattactggcgctcgcattgagttgcgctggataccaggctcatgcg
gcaggtgacgtgatcgccggcaaggcggcctttgcaaaatgcgcaagctgccatcaggtc
ggacgatctgcacgcggcgtctttggcccgcaattgaatggcatcgtcggcaggcctgct
ggtgccacaaaggatttcaaatattcagcagcgatgatgaattcgcgcatcgtctggtca
gaagcatcattgcgtgcctttctcaagtcgccgaacgatgtggtgccggaaaataaaatg
cgcttttttggcatcgggaatgacaggcagattgatgatctgctcgcttacttaagccag
tacaaataa

DBGET integrated database retrieval system