KEGG   Herminiimonas arsenicoxydans: HEAR0921Help
Entry
HEAR0921          CDS       T00490                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00010  Glycolysis / Gluconeogenesis
har00620  Pyruvate metabolism
har00640  Propanoate metabolism
har00680  Methane metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR0921 (acsA)
   00620 Pyruvate metabolism
    HEAR0921 (acsA)
   00640 Propanoate metabolism
    HEAR0921 (acsA)
  Energy metabolism
   00680 Methane metabolism
    HEAR0921 (acsA)
Enzymes [BR:har01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HEAR0921 (acsA)
Lipid biosynthesis proteins [BR:har01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HEAR0921 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAL61105
UniProt: A4G3L8
Position
925555..927537
Genome map
AA seq 660 aa AA seqDB search
MSSIESFKQEGRVFDSPVDFVNNAAISGMEAYRALCAEAADDYEGFWARLAQQNLHWTKP
FTKKLDESNAPFYKWFEDGELNVSWNCLDRHLHNGNADKVAIIFEADDGNVTRITYKELH
ERVCKFANGLKSLSINKGDRVIIYMPMSIDGIAAMQACARIGATHSVVFGGFSAKSLHER
IIDAGAVAVLTADYQVRGGKNLPLKAIVDEALAMGGCDTIRNVVVYKRTGGAVDFVERRD
IWLHELVEQRTSECAPEPVGAEHPLFILYTSGSTGKPKGVQHSSAGYLLWAMLTMKWVFD
IKPNDVYWCTADIGWVTGHTYVTYGPLAVGATQIVFEGVPMYPNAGRFWEMVQKHKVSIF
YTAPTAIRSLIKAAEADPSTHPSKYDLSSLRLLGSVGEPINPEAWMWYYKNIGGERCPIV
DTFWQTETGGHVISPLPGATPMVPGSCTLPLPGIIAAVVDDGGHDLPNGKGGLLVIKRPW
PAMIRNIWNDPERFEKSYFPHELGGRTYLAGDGAIRNEETGYFTITGRIDDVLNISGHRM
GTAEIESALVANPMVAEAAVVGKPDETTGESICAFVVLKRVRPEGDEAKQIAKELRDWVA
KEIGPIAKPKEIRFGDNLPKTRSGKIMRRLLRVLAKDEDITQDISTLENPAILEQLKQAQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtatcgagagcttcaaacaggaggggcgggtattcgattcgcccgtggatttc
gttaacaatgctgctatcagcggcatggaagcgtatcgtgccttgtgtgcggaagcggcc
gacgattacgagggtttctgggcacgccttgcgcagcagaaccttcactggaccaagccg
ttcaccaaaaagctggatgaatccaatgcgcctttttacaaatggtttgaagacggtgaa
ctgaacgtttcctggaattgcctggatcgccacctgcataacggtaatgccgacaaggtc
gccatcatttttgaggccgacgacggtaatgtcacccgcatcacctataaagagttgcac
gaacgcgtctgcaaatttgccaacggcctaaagtcactcagtatcaataagggcgatcgc
gtcatcatctacatgcccatgtcgatcgatggcatcgcagcgatgcaagcctgcgcccgt
atcggtgccacgcattcggtcgtgtttggcggtttttccgccaagtcgctgcatgagcgc
atcattgatgcaggcgcggtggccgtattgaccgcagactatcaagtgcgcggcggcaaa
aatcttcccttgaaagccatcgttgatgaggcactggcgatgggcggttgcgacacaata
cgcaatgttgtcgtctacaaacgtacgggtggcgcagttgattttgtcgagcgccgcgat
atctggctgcatgagctggtcgaacagcgaaccagcgaatgcgcaccggagccggttggt
gccgagcatccgctgtttatcctctacacgtcaggttccaccggcaagccaaaaggcgtg
caacattcatctgccggttatctgctgtgggcgatgctgacgatgaaatgggtgtttgac
atcaagccgaacgatgtctactggtgcaccgccgatattggctgggtcaccggtcacacc
tacgtcacctacggcccgctcgccgttggcgcaacgcagatcgtgtttgaaggcgtgccg
atgtacccgaacgcaggccgtttctgggagatggtgcaaaagcacaaggtttctattttc
tatactgcaccgacagcgatccgttcgctgatcaaggcggcagaagccgatccatccaca
cacccaagcaaatacgatctcagcagcttgcgcctgctcggctcggtcggtgaaccgatc
aatccggaagcatggatgtggtactacaaaaatatcggcggcgaacgttgcccgattgtc
gataccttctggcaaacggaaaccggcggtcacgtcatttcgccattgcctggtgcaacg
cccatggtgccgggctcctgtaccttgccgctaccgggcattattgctgccgtcgtcgat
gatggaggccatgatctgccaaatggcaagggcggcctgctggtcatcaagcgcccatgg
ccggcgatgatccgcaatatctggaacgatcccgagcgtttcgagaaaagctacttcccg
cacgaactcggcggcagaacctatcttgcaggtgacggtgcgatccgcaatgaagaaacc
ggttacttcaccatcactggccgtatcgatgatgtgctcaatatttccggccatcgcatg
ggcacggcagagatcgaatccgcgctggttgccaacccgatggtggcggaagcggcggtg
gtcggaaaaccggatgaaaccactggtgaatcgatctgcgccttcgtcgtgctcaagcgc
gtacgtcctgaaggagatgaggcaaaacagatcgccaaggaattgcgcgactgggtcgca
aaggaaattgggccgatcgccaagccgaaagaaatccgttttggtgacaatctaccgaag
acgcgctccggcaaaatcatgcgccgcctgctgcgcgtgctggccaaggacgaagacatt
acgcaagatatctcgacgctggaaaatccggcaatcctggagcagttgaagcaggcacaa
taa

DBGET integrated database retrieval system