KEGG   Herminiimonas arsenicoxydans: HEAR1008Help
Entry
HEAR1008          CDS       T00490                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:har00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017720..1018502
Genome map
AA seq 260 aa AA seqDB search
MPDSVLGEVVITRPLAQAEGLARRVTALGRKATVFPLLDILPLADQASLQQALRDLSGYA
LIAFVSPNAIDAALAARADWPRDIPMAVVGEGSRLALARHGLTAENSTIISPTDLDRTDS
ETLLAELDLPALRNKQILIVRGETGRPLLSEALRAAGAQVTLLAAYRRVAPVFDATRRRE
LKRLLHGQNDWIVTSSEALRFLMQMVAQLDEAEGVAKMQQQRIIVSHIRIGETAQLLGFS
NITVTRSGDDGLLAALQSRT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattccgtgttgggcgaggtcgtcatcacgcggccgctggcgcaagccgaaggg
ctggcgcgacgcgtgactgcgctgggtcgcaaggcgaccgtgtttcccctgctcgatatt
ttgccgctggccgatcaggcatccctgcagcaagcgctgcgcgatctcagcggctatgcg
ctgattgccttcgttagccccaacgcaatcgatgctgcgctggctgcgcgtgccgattgg
ccgcgcgatattccgatggcagtggtcggcgaaggtagccggctggcattggccaggcac
ggtttgacggcggaaaacagcaccatcatcagtccgaccgatctggatcgcaccgattcc
gaaaccttgctggcggaactggatttgcccgccttgcgcaacaagcagattttgatcgtg
cgcggcgaaaccgggcggccgctgttaagcgaagccttgcgggcagccggtgcgcaggtg
accttgctggccgcttaccgcagagtggcgccggtattcgatgcaacacgccgccgcgaa
ctgaaacgtttattgcatggtcagaacgattggatcgtaaccagttcggaagccttgcgc
tttttgatgcagatggttgcgcaactcgatgaagcagagggcgtcgctaaaatgcaacag
caaagaatcatcgtatcgcatatacgcataggcgaaaccgcgcagttgctgggtttcagt
aatattaccgttactagatcaggcgacgacggactgttagccgcgttacaatctcgcaca
tga

DBGET integrated database retrieval system