KEGG   Herminiimonas arsenicoxydans: HEAR1135Help
Entry
HEAR1135          CDS       T00490                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:har00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:har00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155465..1155893
Genome map
AA seq 142 aa AA seqDB search
MGAISLDHILVTPLARITVEGGDVLHAIKHSDSGYVDFGEAYFSWVAMGAIKAWKRHTRM
TMNIVVPVGQVRFVFHLGGEDSFRIEEIGVEHYARITVPPGIWFGFQGMAEPQSLVLNIA
DIPHDPSEVERATLSHNNYAWK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaataagcctggaccatattttggttacacccttggctcgtattacggtagag
gggggggatgtgctgcatgcgataaagcatagcgatagtggctatgtggatttcggtgag
gcttatttttcctgggtggctatgggggctattaaagcatggaagcgccatacacggatg
acaatgaatattgttgttcctgtgggccaggtcaggtttgtttttcatttgggcggtgag
gactcctttcgcatcgaagagattggtgtggagcattatgcccgtatcactgttccacct
ggtatatggtttggttttcaagggatggcagagccgcaaagtttagtattaaacatcgcc
gatattcctcatgaccctagcgaagttgagcgcgctacgttgtcacataataattacgct
tggaaataa

DBGET integrated database retrieval system