KEGG   Herminiimonas arsenicoxydans: HEAR1171Help
Entry
HEAR1171          CDS       T00490                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:har00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190237..1191076
Genome map
AA seq 279 aa AA seqDB search
MQTHLQCGRYSLPVAATSRPLVMGILNVTPDSFSDAGKYHALDAAISHAEEMIAAGVDII
DIGGESTRPGSQTVSLQDELDRVMPLVYALRDCGKPLSIDTYKPEVMRQTIAAGVDMVND
VNGFRAPGALEAVADADCALCIMHMQKDPQSMQLKPEYENVVADVTAFLHERIAAIAQMN
IARERLCIDPGFGFGKSLAHNIALLKNIGQLQAALDLPLLAGLSRKSMIGALLDKPVERR
MAGSLAGALACVAQGARIVRVHDVAETVDALTVWHAINQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcatttgcaatgcgggcgttacagccttcccgtggcggcaacttcgcgccct
ttggtcatgggcatcttgaatgtcacacccgattctttttccgatgcgggcaaataccat
gctctggatgcagcgatttcgcatgccgaggaaatgattgcagccggcgtggacatcatc
gatatcggtggcgaatctacgcgtcccggctcgcaaacagtgtcattgcaggatgaactc
gatcgcgtgatgccgctggtgtatgcgttgcgcgattgcggcaagccgctttccatcgat
acctacaaaccggaagtgatgcgccaaaccattgcagccggtgtcgacatggttaacgat
gtcaacggtttccgtgcgccgggtgcgctggaagcggtggccgatgcggattgcgcactg
tgcatcatgcacatgcaaaaagatccgcaaagcatgcagttgaaacccgaatatgaaaat
gtggtggccgatgtaaccgcgtttttacatgaacgcatagcggcgatcgcgcagatgaac
attgcgcgggagcgtctgtgcatagatccgggattcggttttgggaaatcgcttgcgcat
aacatcgccttgctgaaaaatatcggacagttgcaggcagcgctggatctgcccttgctg
gccggcctgtcgcgcaagtccatgataggcgcattgctggacaagcctgttgaacggcgt
atggcgggcagtcttgcaggcgctttagcctgtgtcgcacaaggtgcacgtatcgtacgc
gtgcatgatgtagcggaaacggtggatgcattgaccgtgtggcacgcaatcaaccaataa

DBGET integrated database retrieval system