KEGG   Herminiimonas arsenicoxydans: HEAR1171Help
Entry
HEAR1171          CDS       T00490                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00790  Folate biosynthesis
har01100  Metabolic pathways
Module
har_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HEAR1171 (folP)
Enzymes [BR:har01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HEAR1171 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CAL61349
UniProt: A4G4B2
Position
1190237..1191076
Genome map
AA seq 279 aa AA seqDB search
MQTHLQCGRYSLPVAATSRPLVMGILNVTPDSFSDAGKYHALDAAISHAEEMIAAGVDII
DIGGESTRPGSQTVSLQDELDRVMPLVYALRDCGKPLSIDTYKPEVMRQTIAAGVDMVND
VNGFRAPGALEAVADADCALCIMHMQKDPQSMQLKPEYENVVADVTAFLHERIAAIAQMN
IARERLCIDPGFGFGKSLAHNIALLKNIGQLQAALDLPLLAGLSRKSMIGALLDKPVERR
MAGSLAGALACVAQGARIVRVHDVAETVDALTVWHAINQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcatttgcaatgcgggcgttacagccttcccgtggcggcaacttcgcgccct
ttggtcatgggcatcttgaatgtcacacccgattctttttccgatgcgggcaaataccat
gctctggatgcagcgatttcgcatgccgaggaaatgattgcagccggcgtggacatcatc
gatatcggtggcgaatctacgcgtcccggctcgcaaacagtgtcattgcaggatgaactc
gatcgcgtgatgccgctggtgtatgcgttgcgcgattgcggcaagccgctttccatcgat
acctacaaaccggaagtgatgcgccaaaccattgcagccggtgtcgacatggttaacgat
gtcaacggtttccgtgcgccgggtgcgctggaagcggtggccgatgcggattgcgcactg
tgcatcatgcacatgcaaaaagatccgcaaagcatgcagttgaaacccgaatatgaaaat
gtggtggccgatgtaaccgcgtttttacatgaacgcatagcggcgatcgcgcagatgaac
attgcgcgggagcgtctgtgcatagatccgggattcggttttgggaaatcgcttgcgcat
aacatcgccttgctgaaaaatatcggacagttgcaggcagcgctggatctgcccttgctg
gccggcctgtcgcgcaagtccatgataggcgcattgctggacaagcctgttgaacggcgt
atggcgggcagtcttgcaggcgctttagcctgtgtcgcacaaggtgcacgtatcgtacgc
gtgcatgatgtagcggaaacggtggatgcattgaccgtgtggcacgcaatcaaccaataa

DBGET integrated database retrieval system