KEGG   Herminiimonas arsenicoxydans: HEAR1223Help
Entry
HEAR1223          CDS       T00490                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HEAR1223 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR1223 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HEAR1223 (trpB)
Enzymes [BR:har01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HEAR1223 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1242147..1243418
Genome map
AA seq 423 aa AA seqDB search
MKELDALGTYAERQAVSETALHQTAPYNLPDARGHFGQYGGSFVAETLSHALAELRDAYA
HYSKDPAFLAEFHYDLKHFVGRPSPIYHAKRWSEKMGGAQIYFKREDLNHTGAHKINNVI
GQALLARRMGKKRIIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQAQNVYRMKLL
GATVVPVESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
LTQMPEMTSRQPDYVIACIGGGSNAMGIFYPYIEHKNVQLIGVEAAGEGLESGKHSASLM
AGSPGVLHGNRTYLLQDENGQIMETHSISAGLDYPGVGPEHAWLKDSGRAQYVSITDEDA
LQAFHDCCHIEGIIPALESSHALSYAAKLAATLPKEQVVLVNLSGRGDKDMHTVAQRMGL
QFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagatgcgctcggtacatatgccgagcgacaggcagtgagcgaaaccgct
ttgcatcaaaccgcaccttacaatctgccggatgccagaggccacttcgggcaatatggc
ggcagttttgttgccgaaacgctgagtcatgcgctggccgaactgcgggacgcatatgcg
cactacagcaaggatccggctttcctcgcagaattccattacgacctcaagcatttcgtc
ggtcgccccagccctatctatcacgccaaacgctggtctgaaaaaatgggcggcgcgcag
atttatttcaagcgcgaagacttgaatcacactggtgcgcacaagatcaataatgtgatc
ggtcaggctctgctggctcgccgcatgggcaagaagcggatcatcgccgaaaccggtgcc
ggccagcacggcgttgccaccgcgactatctgcgcgcgcttcggccttgaatgcgtggtg
tacatggggagcgaagacgtcaagcgtcaggcgcaaaacgtgtaccggatgaagctgctc
ggtgccacggtggtgccggtcgagtccggctccaaaacactcaaggatgcgctgaatgaa
gccatgcgcgactgggttaccaacattgaaaacaccttttacatcataggcaccgttgcc
ggcccgcatccatatccgatgatggtgcgcgattttcaatcggtgataggaaatgaatgc
ctgacgcaaatgccggaaatgaccagccgtcaaccggattacgtgattgcctgcataggc
ggcggctcgaatgcgatgggaattttttatccttatatcgaacacaaaaatgtgcaactg
atcggtgtcgaagcagccggtgaaggactggaaagcggcaagcattcggcgtcgctgatg
gccggctcgcctggcgtgttgcacggtaaccgtacctatctgttgcaggatgagaatggc
cagatcatggaaacgcattccatctcggccggcctcgattatccaggtgtcgggcctgaa
catgcatggctgaaagactccggtcgtgcgcaatatgtgtctattaccgatgaagatgca
ttacaggcgtttcacgattgctgccatatcgagggcattattcccgcgctggaatcgagt
catgccttgagctatgcggccaagctggcagcaaccttgccgaaagaacaggtcgtgctg
gtcaatctttccggtcgtggcgacaaggatatgcatacggtggcgcagcgcatgggtttg
cagttcgactga

DBGET integrated database retrieval system