KEGG   Herminiimonas arsenicoxydans: HEAR1223Help
Entry
HEAR1223          CDS       T00490                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:har01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:har00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:har00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242147..1243418
Genome map
AA seq 423 aa AA seqDB search
MKELDALGTYAERQAVSETALHQTAPYNLPDARGHFGQYGGSFVAETLSHALAELRDAYA
HYSKDPAFLAEFHYDLKHFVGRPSPIYHAKRWSEKMGGAQIYFKREDLNHTGAHKINNVI
GQALLARRMGKKRIIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQAQNVYRMKLL
GATVVPVESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
LTQMPEMTSRQPDYVIACIGGGSNAMGIFYPYIEHKNVQLIGVEAAGEGLESGKHSASLM
AGSPGVLHGNRTYLLQDENGQIMETHSISAGLDYPGVGPEHAWLKDSGRAQYVSITDEDA
LQAFHDCCHIEGIIPALESSHALSYAAKLAATLPKEQVVLVNLSGRGDKDMHTVAQRMGL
QFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagatgcgctcggtacatatgccgagcgacaggcagtgagcgaaaccgct
ttgcatcaaaccgcaccttacaatctgccggatgccagaggccacttcgggcaatatggc
ggcagttttgttgccgaaacgctgagtcatgcgctggccgaactgcgggacgcatatgcg
cactacagcaaggatccggctttcctcgcagaattccattacgacctcaagcatttcgtc
ggtcgccccagccctatctatcacgccaaacgctggtctgaaaaaatgggcggcgcgcag
atttatttcaagcgcgaagacttgaatcacactggtgcgcacaagatcaataatgtgatc
ggtcaggctctgctggctcgccgcatgggcaagaagcggatcatcgccgaaaccggtgcc
ggccagcacggcgttgccaccgcgactatctgcgcgcgcttcggccttgaatgcgtggtg
tacatggggagcgaagacgtcaagcgtcaggcgcaaaacgtgtaccggatgaagctgctc
ggtgccacggtggtgccggtcgagtccggctccaaaacactcaaggatgcgctgaatgaa
gccatgcgcgactgggttaccaacattgaaaacaccttttacatcataggcaccgttgcc
ggcccgcatccatatccgatgatggtgcgcgattttcaatcggtgataggaaatgaatgc
ctgacgcaaatgccggaaatgaccagccgtcaaccggattacgtgattgcctgcataggc
ggcggctcgaatgcgatgggaattttttatccttatatcgaacacaaaaatgtgcaactg
atcggtgtcgaagcagccggtgaaggactggaaagcggcaagcattcggcgtcgctgatg
gccggctcgcctggcgtgttgcacggtaaccgtacctatctgttgcaggatgagaatggc
cagatcatggaaacgcattccatctcggccggcctcgattatccaggtgtcgggcctgaa
catgcatggctgaaagactccggtcgtgcgcaatatgtgtctattaccgatgaagatgca
ttacaggcgtttcacgattgctgccatatcgagggcattattcccgcgctggaatcgagt
catgccttgagctatgcggccaagctggcagcaaccttgccgaaagaacaggtcgtgctg
gtcaatctttccggtcgtggcgacaaggatatgcatacggtggcgcagcgcatgggtttg
cagttcgactga

DBGET integrated database retrieval system