KEGG   Herminiimonas arsenicoxydans: HEAR1224Help
Entry
HEAR1224          CDS       T00490                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HEAR1224 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR1224 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HEAR1224 (trpA)
Enzymes [BR:har01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HEAR1224 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1243509..1244306
Genome map
AA seq 265 aa AA seqDB search
MSRIQSTFAALAAKNKKGLIPFITAGDPAPDLTVPLMHALVAGGADILELGVPFSDPMAE
GPVIQRACERALKFNVSLHDVLGFVSEFRKTDTTTPVVLMGYANPIERMGQTAFVLAAKA
AGVDGTIVVDYPPEECEEFAATLKANDMDPIFLLSPTSTEERIQQVAKFGSGFSYYVSLK
GVTGSANIDTQDVAQRIEAIRKHVKLPIGVGFGIRDAATAKAVATVSDAVVIGSRIIQEL
ENTPRERAVEAAQTFISGIRKALDE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaatccaatctacctttgccgcattggcggccaagaataaaaaaggcttgatc
cctttcatcacggcaggcgatccggcaccggatctgaccgtgccgctgatgcatgcatta
gtggctggcggtgccgatatccttgaactgggtgtgccgttttccgatcccatggcggaa
ggcccggtgatacagcgcgcctgcgaacgggcgctgaaattcaacgtcagcctgcacgat
gtactcggttttgtcagtgaatttcgcaagaccgataccacgactccagtcgtcctgatg
ggatatgccaatccgatcgagcgcatggggcaaaccgcttttgtcctggcggcgaaagct
gccggcgtggatggcaccattgttgtcgattacccgccggaagagtgtgaagagttcgcc
gcgacgctcaaggccaacgatatggatcctatcttcctgctgtcgccgacttcgactgaa
gagcgcatccagcaggtggccaaattcggtagcggcttcagctattacgtttcgctcaag
ggagtcaccggctccgccaatatcgatacgcaggatgtcgcgcagcgtattgaggcgata
cgcaaacatgtgaaattgccaatcggcgttggcttcggcatccgcgatgcagcaacagcc
aaggcggtggccaccgtatcggatgcggtggtgattggcagccgcatcattcaggaactg
gaaaatacaccgcgtgagcgtgcagtggaagcggcgcagacatttatttccggcatccgc
aaggcactggacgaataa

DBGET integrated database retrieval system