KEGG   Herminiimonas arsenicoxydans: HEAR1255Help
Entry
HEAR1255          CDS       T00490                                 

Definition
(GenBank) putative L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HEAR1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 RrnaAD
Motif
Other DBs
NCBI-ProteinID: CAL61430
UniProt: A4G4J3
Position
1273765..1274631
Genome map
AA seq 288 aa AA seqDB search
MTDKAKRFPLSLSSLSEKAPRNGARSDPQHVAGKTATPQTATLNASRHGKAPVVPRQQDV
PHKIAAPTAPRSASLVSDAIRKAMTARVAKQGVTDSKVLAAMEAVPRHLFMEPALASQAY
IDASLPIGYHQTISQPYIVARMIEVMRNNSNAGVLNCVLEIGTGCGYQAAVLSLVAKEVY
SIERIKGLHELAKSNLRPMRVANIRLHYGDGMLGLPQAAPFDGIILAAAGLEVPQALLEQ
LTIGGRLVAPVGDRHQVLQLIERVSKFEWKSSTLEDCHFVPLRPGTVT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaaggccaagcgttttccactgtcgctttcctccctttcggaaaaagcacca
cgcaacggtgcgcgcagcgatcctcagcatgttgcgggaaagactgctacgccgcagacg
gcgacgctgaatgcctcccggcacggcaaagcaccggtagtaccacggcagcaggacgta
ccgcacaagatcgccgcgccgactgcgccgcgtagcgcatcgctggtgtcggatgcgatc
cgcaaggccatgacggcgcgcgtggccaaacagggggtgacagacagcaaggtgctggcg
gcgatggaagcggtgccgcgtcatttgttcatggagccggcgttggccagccaggcgtat
atcgatgcttcgttgccaattggctatcaccagacaatctcgcagccgtatatcgtggca
agaatgattgaagtcatgcggaacaatagcaatgccggcgtactcaattgtgttctggaa
attggcacgggctgcggttatcaggcggcggtgctgtcgctagtggccaaggaagtctat
tccatcgaacgcatcaagggtttgcacgaactggcgaaatccaacttgcggcccatgcgc
gtggcaaatatccgcttgcattacggagatggtatgcttggcctgcctcaggcagcgccg
tttgacggcattattttggccgccgccggactggaagtgccgcaggccttgctggaacaa
ctgacaataggcggccgactggttgccccggttggcgaccgtcatcaggttctgcaactg
atagagcgcgtcagcaaatttgaatggaaaagttcgacgctggaggattgccattttgtg
ccgctccgtccgggtaccgtaacttga

DBGET integrated database retrieval system