KEGG   Herminiimonas arsenicoxydans: HEAR1329Help
Entry
HEAR1329          CDS       T00490                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HEAR1329 (galU)
   00052 Galactose metabolism
    HEAR1329 (galU)
   00500 Starch and sucrose metabolism
    HEAR1329 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HEAR1329 (galU)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HEAR1329 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1348293..1349168
Genome map
AA seq 291 aa AA seqDB search
MNKIRKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVAAGITEMIFITGRN
KRAIEDHFDTAYELERELEAAGKTALLEFVQNVIPKHVNCIYIRQSAPLGLGHAVLCARP
VVGNEPFAVLLADDFMDTPAGTAPVLAQMVEIFEREGSSILAVQDVPRAETRQYGIVSAT
PYQDRLEQVDAIVEKPQPEDAPSTLAVVGRYILSGRIFDYLENVSQGAGGEIQLTDGIAA
LMRDQKVLAYRYEGQRYDCGSKLGYLKAMVDMGRKHPETGAAFTEYLKTLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattagaaaagcagtgttcccggttgcaggcctgggcagccgtttcctgccc
gccaccaaggcgcaaccgaaagagatgctgccgatagtggacaagcccctgatccagtac
gcggtggaagaggcggttgcagccggcatcacggaaatgatcttcattaccggccgcaac
aagcgcgcaatagaagatcacttcgacaccgcatacgaactggaacgcgaactggaagcg
gcgggaaaaaccgcgctgctggagttcgtgcagaatgtgatccccaagcatgtgaattgc
atttacatccgtcaatctgccccgctgggtctgggccatgcagtgctgtgcgcgcgcccg
gtggtcggcaacgaaccgtttgcggtactgctggcggatgacttcatggatacgccggcc
ggcacggcgccggtactggcgcagatggttgaaatttttgaacgtgaaggcagcagcatc
cttgccgtgcaggacgtgccgcgcgcagaaaccaggcaatacggtatcgtcagcgcaacg
ccgtatcaggacaggctggagcaggtcgatgcgatcgtcgaaaagccgcagccggaagat
gcgccttcgacgctggcggtggtcgggcgttatatcctgagcggcaggatattcgattac
ctggaaaatgtgagtcagggcgcgggtggcgaaatacaattgaccgacggcattgcggcc
ctgatgcgcgatcaaaaggtgctggcttaccgttatgaaggtcagcgttatgattgtggt
tccaagctgggttatctgaaggcgatggtggacatggggcgcaagcatccggaaaccggc
gccgcctttacagaatatttgaagacactgaaatga

DBGET integrated database retrieval system