KEGG   Herminiimonas arsenicoxydans: HEAR1329Help
Entry
HEAR1329          CDS       T00490                                 

Gene name
galU
Definition
(GenBank) Glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:har00001]
   00040 Pentose and glucuronate interconversions
    HEAR1329 (galU)
   00052 Galactose metabolism
    HEAR1329 (galU)
   00500 Starch and sucrose metabolism
    HEAR1329 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HEAR1329 (galU)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HEAR1329 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1348293..1349168
Genome map
AA seq 291 aa AA seqDB search
MNKIRKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVAAGITEMIFITGRN
KRAIEDHFDTAYELERELEAAGKTALLEFVQNVIPKHVNCIYIRQSAPLGLGHAVLCARP
VVGNEPFAVLLADDFMDTPAGTAPVLAQMVEIFEREGSSILAVQDVPRAETRQYGIVSAT
PYQDRLEQVDAIVEKPQPEDAPSTLAVVGRYILSGRIFDYLENVSQGAGGEIQLTDGIAA
LMRDQKVLAYRYEGQRYDCGSKLGYLKAMVDMGRKHPETGAAFTEYLKTLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattagaaaagcagtgttcccggttgcaggcctgggcagccgtttcctgccc
gccaccaaggcgcaaccgaaagagatgctgccgatagtggacaagcccctgatccagtac
gcggtggaagaggcggttgcagccggcatcacggaaatgatcttcattaccggccgcaac
aagcgcgcaatagaagatcacttcgacaccgcatacgaactggaacgcgaactggaagcg
gcgggaaaaaccgcgctgctggagttcgtgcagaatgtgatccccaagcatgtgaattgc
atttacatccgtcaatctgccccgctgggtctgggccatgcagtgctgtgcgcgcgcccg
gtggtcggcaacgaaccgtttgcggtactgctggcggatgacttcatggatacgccggcc
ggcacggcgccggtactggcgcagatggttgaaatttttgaacgtgaaggcagcagcatc
cttgccgtgcaggacgtgccgcgcgcagaaaccaggcaatacggtatcgtcagcgcaacg
ccgtatcaggacaggctggagcaggtcgatgcgatcgtcgaaaagccgcagccggaagat
gcgccttcgacgctggcggtggtcgggcgttatatcctgagcggcaggatattcgattac
ctggaaaatgtgagtcagggcgcgggtggcgaaatacaattgaccgacggcattgcggcc
ctgatgcgcgatcaaaaggtgctggcttaccgttatgaaggtcagcgttatgattgtggt
tccaagctgggttatctgaaggcgatggtggacatggggcgcaagcatccggaaaccggc
gccgcctttacagaatatttgaagacactgaaatga

DBGET integrated database retrieval system