KEGG   Herminiimonas arsenicoxydans: HEAR1341Help
Entry
HEAR1341          CDS       T00490                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00900  Terpenoid backbone biosynthesis
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HEAR1341 (dxr)
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HEAR1341 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FAD_binding_2 Peptidase_S66 Semialdhyde_dh Sacchrp_dh_NADP NmrA
Motif
Other DBs
NCBI-ProteinID: CAL61514
UniProt: A4G4S7
Position
1362047..1363222
Genome map
AA seq 391 aa AA seqDB search
MQHITILGSTGSIGVSTLDVVARHPDRYRVHALTAQNKVEELAAQCAQFHPDVAVVGSAE
AAQKLQVLLNGMGLQTQVEYGAAALCTVASAPECDCVMAAIVGGAGLAPTLAAARAGKKI
LLANKEALVMSGPLLMEAVAASGAILMPIDSEHNAIFQCMPATYHQQQLTPAQHGIEKIL
LTASGGPFLNRALDTLDQVTCAEAIAHPKWVMGRKISVDSATMMNKGLEVIEAHWLFGVP
ADRIEVVIHPQSVVHSMVSYIDGSVLAQLGNPDMRTPIAHAMAYPERIDSGVAPIDLIKI
AQLTFEHPDLLRFPCLKLAYDALQAGGSAPAIMNAANEIAVQAFLDGRIGFRAIDQLIAR
VMAALPSSPVTDIDTVFEQDRRARDTAASFI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatataaccatactgggttcaaccgggtccataggcgtatcgacactggacgtg
gtggcgcgtcatcccgatcgttaccgcgtgcatgccttgacggcgcaaaacaaggtggag
gaactggcggcacaatgtgcgcagtttcatccggatgtggcggtcgtcggcagcgctgaa
gcggcgcaaaaattgcaagtgctgctaaacggaatgggcttgcagacgcaggtcgaatac
ggtgctgcagccttgtgcacagtagccagtgcgcctgagtgcgattgcgtgatggcggcc
atcgttggtggagccggcctggcgcctaccttggcggcagcgcgtgccggcaaaaaaata
ttgctggccaacaaggaggcgctggtcatgtccggccctttgctgatggaagcggtcgct
gccagcggcgcgatcctgatgcctatcgacagcgaacacaatgcgattttccagtgcatg
ccggcgacgtatcatcaacagcagctcacgccagcgcagcacgggatagaaaaaattctg
ctgacagcctccggcggccctttcctcaatcgggctctcgatacgctggatcaggtgacc
tgcgccgaagcgattgcgcatcccaaatgggtgatgggccgcaagatttcggtggactcg
gccacgatgatgaacaagggcctggaagtgatagaggcgcactggctgttcggtgtgccg
gccgaccgtatcgaagtagtgatacacccgcagagtgtcgtgcattcgatggtgtcgtac
atcgatggttcggtgctggcgcaactgggcaatccggacatgcgcacgccgattgcacat
gccatggcgtatccggaacgtatcgattccggcgtcgcgccgatcgacttgatcaagatc
gcgcaacttactttcgagcatcccgatctgctccgatttccatgcctgaaactggcgtat
gatgcattgcaggcgggcggttctgcgccggccatcatgaatgccgcgaatgagattgcc
gtgcaggcctttcttgatggacgcatcggctttcgtgccattgatcaattgattgcacgt
gtgatggcggccttgccgtccagcccggttaccgacatcgataccgtttttgaacaggat
agacgggcgcgcgacacagccgcttccttcatataa

DBGET integrated database retrieval system