KEGG   Herminiimonas arsenicoxydans: HEAR1747Help
Entry
HEAR1747          CDS       T00490                                 

Gene name
tesA
Definition
multifunctional: acyl-CoA thioesterase I; protease I; lysophospholipasel(I) (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HEAR1747 (tesA)
Enzymes [BR:har01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HEAR1747 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HEAR1747 (tesA)
Lipid biosynthesis proteins [BR:har01004]
 Fatty acid synthase
  Component type
   HEAR1747 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756088..1756738
Genome map
AA seq 216 aa AA seqDB search
MGNILKTALKTTLQTVTLVVFTSFATSAYSASKTILVLGDSLSAEYGLARGEGWVNLLQK
KLATEKISASIVNASISGETTSGGKARLPSLLIKHQPAIVVIELGANDALRGLSLAATQE
NLRAMIKSAKAAKAKILLIGMQIPPNYGSDYTKQFSALFPKLAQETKSSLVPFMLQGVAE
KPELFQADRIHPSAEAHPRILDNIWPQLKPLLIGGK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaatatattaaaaacggcattaaaaacgacattacaaacagtgacactggttgtt
tttacgtcattcgcaacgagcgcttattctgcatcaaaaaccatcctcgtgctcggcgac
agcctgtcggcagaatatggcctggcacgtggcgaaggctgggtcaatctgctgcagaaa
aaactggccacggaaaaaatctctgcttccattgtcaatgccagcatcagcggcgaaacc
accagcggcggcaaagcgagattgccgtccctgctgatcaaacatcaaccggcaatcgtc
gtgatagagttgggtgcaaacgatgcactacgcggcttgtcgctcgcggcgacgcaggaa
aatctgcgcgccatgattaaaagcgccaaggcggccaaggcaaaaatcctgttgatcggc
atgcagataccacccaactatggcagcgattacaccaaacagttctctgccctatttccc
aaactggcacaggaaaccaaatcttctctggttccattcatgctgcagggcgtggccgaa
aaacctgaactgttccaggccgatcgcattcatcccagcgccgaagcgcacccgagaata
ctcgacaatatctggccgcaactcaaaccgttgctgatcggcggaaaataa

DBGET integrated database retrieval system