KEGG   Herminiimonas arsenicoxydans: HEAR1771Help
Entry
HEAR1771          CDS       T00490                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HEAR1771 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HEAR1771 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HEAR1771 (sucB)
Enzymes [BR:har01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HEAR1771 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1781316..1782560)
Genome map
AA seq 414 aa AA seqDB search
MAILEITVPQLSESVAEATLLQWHKKVGETVARDENMIDIETDKVVLELPAPAAGVITQI
IRDDNSTVVAGEVIALLDTDLSAAVAPAASAPAAATAAPTAAPAMAASANAASNIAMPAA
AKMLAENQLAASDVAGTGKDGRVTKGDVINQLEKKQAAPVATAAKPALQQVTAPMSATML
ANRPEERVPMSRLRARIAERLLQSQSSNAILTTFNEVNMQPVMDLRAKYKDKFEKEHGVK
LGFMSFFVKAVVAALKKYPIINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRDADQMT
IAEIEKKIAEFGNKAKEGKLTLDDLNGGTFSISNGGVFGSMLSTPIINPPQSAILGIHAT
KERAVVENGQIVIRPMNYFAMSYDHRIIDGREAVLGLVAMKEAMEDPARLLLDL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggctattcttgagatcacagttccgcaattgtcggaatccgttgcagaagcaacgctg
ctgcaatggcataaaaaggtgggcgagaccgtcgcgcgcgacgaaaacatgatcgatatc
gaaaccgacaaggttgtgctggaattgccggcaccggccgccggcgtgatcacgcaaatc
attcgcgatgacaacagtaccgtggttgcgggtgaagttattgccttgctcgataccgat
ctgtcggctgcggttgcccctgcagcgtccgctcctgcagcagcaactgcggcgccaact
gctgcacctgcaatggcggcatccgcgaatgctgccagcaatattgcaatgccggccgca
gcaaaaatgctggcggagaaccagctggcagcgagcgatgttgccggcaccggcaaggat
ggccgtgtcaccaaaggcgatgtcatcaatcagctggagaaaaaacaggcagcgcctgta
gcgacagcagccaaacccgctctgcagcaagtgactgcgcccatgtcggccactatgctg
gccaatcgtccggaagagcgcgtgcccatgagccgcttgcgcgcccgtatcgccgagcgt
ttgctgcagtcgcaatcgagtaatgccatattgactacgttcaacgaagtcaatatgcag
ccggtgatggatctgcgtgccaagtacaaggacaagttcgaaaaagaacacggtgtcaaa
ctcggcttcatgtcatttttcgtcaaggcagtggttgctgcattgaaaaaatatccgatc
atcaatgcatcggtagacggtaatgacatcgtctatcacggctacttcgatatcggcatt
gccgtcggttcgccacgcggactggtggtgccgatcctgcgcgatgccgatcaaatgact
atcgctgaaattgaaaagaagattgcggaatttggcaacaaggccaaagaaggcaagctg
acgctggacgatctgaacggcggcactttctcgatttcaaacggcggcgtattcggttcg
atgctgtcgacgcctatcatcaacccaccgcaatcggcgattctggggatacatgcaacc
aaggagcgcgcagtggttgaaaacgggcagatcgtgatccgtccgatgaactacttcgcc
atgtcttacgatcatcgcatcatcgatggtcgcgaagccgtgctggggctggtggcgatg
aaggaagcgatggaagaccctgcgcgcctgttgctggacctttaa

DBGET integrated database retrieval system