KEGG   Herminiimonas arsenicoxydans: HEAR1828Help
Entry
HEAR1828          CDS       T00490                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HEAR1828 (tpiA)
   01230 Biosynthesis of amino acids
    HEAR1828 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR1828 (tpiA)
   00051 Fructose and mannose metabolism
    HEAR1828 (tpiA)
   00562 Inositol phosphate metabolism
    HEAR1828 (tpiA)
Enzymes [BR:har01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HEAR1828 (tpiA)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HEAR1828 (tpiA)
  Exosomal proteins of bladder cancer cells
   HEAR1828 (tpiA)
  Exosomal proteins of melanoma cells
   HEAR1828 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1840748..1841494)
Genome map
AA seq 248 aa AA seqDB search
MRRKLVAGNWKMNGSLAANALLLAEIKAEFGNPACDVAVCVPAPYLAQCLSLLSDSTIAL
GAQDVSSHDSGAYTGEVSTAMLLEFACRYVIVGHSERRAYFGETNELVAQKTVRALSAGL
MPIVCVGETLEQREAGQTDEVVGRQIDAVLSSIAENDLAKIVVAYEPVWAIGTGKTATPE
MAQEVHVMLRRRLHAKNAQAATEVRILYGGSMKPDNAKELLAMPDIDGGLIGGAALKAAD
FLAIIRAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaaactcgtcgcaggcaactggaaaatgaatggcagtcttgctgccaatgct
cttttgctggcagagatcaaagccgagtttggcaatcccgcatgtgatgtggccgtatgt
gttcctgcaccttatcttgctcagtgcctttcattgttgtcggatagcacgattgcactg
ggtgcgcaggatgtgtcgagtcacgattccggtgcctatactggtgaagtatcaactgcg
atgctgctggagtttgcctgtcgttatgtgattgtcggtcactccgaacggcgtgcatat
tttggcgagacgaatgagctggtagcacaaaaaacagtgcgcgccctgagtgctggtttg
atgcctatcgtctgtgttggtgagacgctggagcagcgcgaagcagggcagaccgatgag
gtcgtgggtcggcaaatcgatgcggtgttgtcatcgattgcagaaaatgatctggcgaaa
atagtagtggcgtacgagccggtttgggcgatcggcacgggcaagacggcgacgccagag
atggcgcaggaagtccatgtcatgttgcgcaggcgcttgcatgcaaagaatgcgcaagct
gcaacagaagtgagaattttgtacggcggcagcatgaagccggataacgccaaagagttg
ctcgccatgccggatatcgatggcggtttaattggcggggcggcattgaaggcggcggat
tttctggcgattatccgcgcggcatag

DBGET integrated database retrieval system