KEGG   Herminiimonas arsenicoxydans: HEAR1828Help
Entry
HEAR1828          CDS       T00490                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00010  Glycolysis / Gluconeogenesis
har00051  Fructose and mannose metabolism
har00562  Inositol phosphate metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
har01230  Biosynthesis of amino acids
Module
har_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR1828 (tpiA)
   00051 Fructose and mannose metabolism
    HEAR1828 (tpiA)
   00562 Inositol phosphate metabolism
    HEAR1828 (tpiA)
Enzymes [BR:har01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HEAR1828 (tpiA)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HEAR1828 (tpiA)
  Exosomal proteins of bladder cancer cells
   HEAR1828 (tpiA)
  Exosomal proteins of melanoma cells
   HEAR1828 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAL61983
UniProt: A4G646
Position
complement(1840748..1841494)
Genome map
AA seq 248 aa AA seqDB search
MRRKLVAGNWKMNGSLAANALLLAEIKAEFGNPACDVAVCVPAPYLAQCLSLLSDSTIAL
GAQDVSSHDSGAYTGEVSTAMLLEFACRYVIVGHSERRAYFGETNELVAQKTVRALSAGL
MPIVCVGETLEQREAGQTDEVVGRQIDAVLSSIAENDLAKIVVAYEPVWAIGTGKTATPE
MAQEVHVMLRRRLHAKNAQAATEVRILYGGSMKPDNAKELLAMPDIDGGLIGGAALKAAD
FLAIIRAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaaactcgtcgcaggcaactggaaaatgaatggcagtcttgctgccaatgct
cttttgctggcagagatcaaagccgagtttggcaatcccgcatgtgatgtggccgtatgt
gttcctgcaccttatcttgctcagtgcctttcattgttgtcggatagcacgattgcactg
ggtgcgcaggatgtgtcgagtcacgattccggtgcctatactggtgaagtatcaactgcg
atgctgctggagtttgcctgtcgttatgtgattgtcggtcactccgaacggcgtgcatat
tttggcgagacgaatgagctggtagcacaaaaaacagtgcgcgccctgagtgctggtttg
atgcctatcgtctgtgttggtgagacgctggagcagcgcgaagcagggcagaccgatgag
gtcgtgggtcggcaaatcgatgcggtgttgtcatcgattgcagaaaatgatctggcgaaa
atagtagtggcgtacgagccggtttgggcgatcggcacgggcaagacggcgacgccagag
atggcgcaggaagtccatgtcatgttgcgcaggcgcttgcatgcaaagaatgcgcaagct
gcaacagaagtgagaattttgtacggcggcagcatgaagccggataacgccaaagagttg
ctcgccatgccggatatcgatggcggtttaattggcggggcggcattgaaggcggcggat
tttctggcgattatccgcgcggcatag

DBGET integrated database retrieval system