KEGG   Herminiimonas arsenicoxydans: HEAR1864Help
Entry
HEAR1864          CDS       T00490                                 

Definition
(GenBank) Conserved hypothetical protein, putative GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     HEAR1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1882878..1884452
Genome map
AA seq 524 aa AA seqDB search
MPDKPTQNPAEIAREAFRQLATRKIAPTPDAYRKIYDEIAGYAIQPSAEEVLGEFAGTLL
SAPDLAPLGKALQEAAATSYWPDFSKGLEQLIKHYQTQLSARSTTVSSTNNVAGSTLPSL
IDDPQPALLRDLLMRTLTLAVASLLQGAPELAEESEALGRSIKEAQSEAALNEVSVRLKQ
LCFKIELKSGDMAEQHELLLRLFKLLLENISGLIDDDSWMHGQIEAVQNLIIGPINDIAL
REVMRSLKEVIYKQGTLRNSLVEAKDTVKDMMITFIDRLGEIATTTGNYHKKIDKYSKQI
IATADVSKLSKILDEVMKETRIAQSEALRSRDAILAARKNVEDAEARIHNLETKLEQMSE
LVREDQLTGSLNRRGLEDIFERELARAERRGTPLCIAMLDLDDFKKINDKYGHSAGDEAL
IHLVRVIKETLRSMDVIARFGGEEFLIVLPDTGMDEAVQTVTRLQRELTKQIFMHNHTRL
LMTFSAGVALRNEREDQRAMIERADKALYEAKRTGKNRVVAAAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaaaccaacgcaaaaccctgcagaaattgcacgcgaagcatttcgccagtta
gccacccgcaagattgcccctacccccgacgcctatcgcaagatttacgacgagatcgct
ggttatgcgatacaacccagcgcagaagaagtgctcggcgaatttgccggcaccctgctc
tccgctcccgaccttgcgccgctaggtaaagcattacaggaagccgcggcaacatcctac
tggccggatttcagcaaaggcctggaacaactgatcaagcattatcagactcagctgtct
gcacgcagcacgactgtctccagcaccaacaatgtcgccggcagtacgctgccatcgctg
atcgacgacccgcaaccggccctgttacgcgacttgctgatgcgcacgctgacgctggcg
gtcgcctcgctgctgcagggtgcgccggagttggcggaagaatccgaagcgctcggacgc
tccatcaaggaggcacaaagcgaagccgcgctcaatgaagtttccgtacggctgaagcag
ctctgcttcaagatcgaactcaagagcggcgatatggccgagcagcatgaactgctgctg
cgcctgttcaagctgctgctggaaaacatcagcggcctgatcgacgacgattcatggatg
catggacagatcgaagcagtccagaacctgatcatcggcccgatcaacgacatcgcgctg
cgcgaagtcatgcgcagcctgaaagaagtgatctacaagcaaggcacgctgagaaacagc
ctggttgaagcaaaagacacggtaaaggacatgatgatcacgtttatcgaccggctcggc
gagatcgccaccaccaccggcaattatcacaagaaaatcgacaagtactccaaacagatc
atcgccaccgccgatgtcagcaagctgagcaagatcctcgatgaagtgatgaaggaaaca
cggatagcgcaaagcgaggccttgcgttcgcgcgacgcgatcctggcggcacgcaaaaac
gtggaagatgcagaagcacgcatccacaatctggaaaccaaactcgaacaaatgagcgaa
ttggtgcgcgaagaccaattgaccggcagcctcaaccgccgcggcctggaagatatcttt
gaacgcgaactggcgcgcgccgagcggcgtggcacgccactctgcatcgccatgctcgat
ctggacgacttcaagaagatcaacgacaaatacggccactccgccggtgacgaagcgcta
atccatctggtacgcgtgatcaaggaaaccttacgctcgatggacgtcatcgcccgcttc
ggcggtgaagagtttctcatcgtgctgccggataccggcatggatgaggccgttcagacg
gtcacgcgtttgcaaagagaattgaccaagcagatcttcatgcataaccacacgcgcctg
ctgatgaccttcagcgctggcgttgccttgcgcaatgaacgagaagaccagcgcgcaatg
atagagcgcgctgacaaggctttgtacgaagccaagcgtacgggcaaaaaccgcgtcgtg
gcagcggcgcagtaa

DBGET integrated database retrieval system