KEGG   Herminiimonas arsenicoxydans: HEAR1864Help
Entry
HEAR1864          CDS       T00490                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
har  Herminiimonas arsenicoxydans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1882878..1884452
Genome map
AA seq 524 aa AA seqDB search
MPDKPTQNPAEIAREAFRQLATRKIAPTPDAYRKIYDEIAGYAIQPSAEEVLGEFAGTLL
SAPDLAPLGKALQEAAATSYWPDFSKGLEQLIKHYQTQLSARSTTVSSTNNVAGSTLPSL
IDDPQPALLRDLLMRTLTLAVASLLQGAPELAEESEALGRSIKEAQSEAALNEVSVRLKQ
LCFKIELKSGDMAEQHELLLRLFKLLLENISGLIDDDSWMHGQIEAVQNLIIGPINDIAL
REVMRSLKEVIYKQGTLRNSLVEAKDTVKDMMITFIDRLGEIATTTGNYHKKIDKYSKQI
IATADVSKLSKILDEVMKETRIAQSEALRSRDAILAARKNVEDAEARIHNLETKLEQMSE
LVREDQLTGSLNRRGLEDIFERELARAERRGTPLCIAMLDLDDFKKINDKYGHSAGDEAL
IHLVRVIKETLRSMDVIARFGGEEFLIVLPDTGMDEAVQTVTRLQRELTKQIFMHNHTRL
LMTFSAGVALRNEREDQRAMIERADKALYEAKRTGKNRVVAAAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaaaccaacgcaaaaccctgcagaaattgcacgcgaagcatttcgccagtta
gccacccgcaagattgcccctacccccgacgcctatcgcaagatttacgacgagatcgct
ggttatgcgatacaacccagcgcagaagaagtgctcggcgaatttgccggcaccctgctc
tccgctcccgaccttgcgccgctaggtaaagcattacaggaagccgcggcaacatcctac
tggccggatttcagcaaaggcctggaacaactgatcaagcattatcagactcagctgtct
gcacgcagcacgactgtctccagcaccaacaatgtcgccggcagtacgctgccatcgctg
atcgacgacccgcaaccggccctgttacgcgacttgctgatgcgcacgctgacgctggcg
gtcgcctcgctgctgcagggtgcgccggagttggcggaagaatccgaagcgctcggacgc
tccatcaaggaggcacaaagcgaagccgcgctcaatgaagtttccgtacggctgaagcag
ctctgcttcaagatcgaactcaagagcggcgatatggccgagcagcatgaactgctgctg
cgcctgttcaagctgctgctggaaaacatcagcggcctgatcgacgacgattcatggatg
catggacagatcgaagcagtccagaacctgatcatcggcccgatcaacgacatcgcgctg
cgcgaagtcatgcgcagcctgaaagaagtgatctacaagcaaggcacgctgagaaacagc
ctggttgaagcaaaagacacggtaaaggacatgatgatcacgtttatcgaccggctcggc
gagatcgccaccaccaccggcaattatcacaagaaaatcgacaagtactccaaacagatc
atcgccaccgccgatgtcagcaagctgagcaagatcctcgatgaagtgatgaaggaaaca
cggatagcgcaaagcgaggccttgcgttcgcgcgacgcgatcctggcggcacgcaaaaac
gtggaagatgcagaagcacgcatccacaatctggaaaccaaactcgaacaaatgagcgaa
ttggtgcgcgaagaccaattgaccggcagcctcaaccgccgcggcctggaagatatcttt
gaacgcgaactggcgcgcgccgagcggcgtggcacgccactctgcatcgccatgctcgat
ctggacgacttcaagaagatcaacgacaaatacggccactccgccggtgacgaagcgcta
atccatctggtacgcgtgatcaaggaaaccttacgctcgatggacgtcatcgcccgcttc
ggcggtgaagagtttctcatcgtgctgccggataccggcatggatgaggccgttcagacg
gtcacgcgtttgcaaagagaattgaccaagcagatcttcatgcataaccacacgcgcctg
ctgatgaccttcagcgctggcgttgccttgcgcaatgaacgagaagaccagcgcgcaatg
atagagcgcgctgacaaggctttgtacgaagccaagcgtacgggcaaaaaccgcgtcgtg
gcagcggcgcagtaa

DBGET integrated database retrieval system