KEGG   Herminiimonas arsenicoxydans: HEAR2266Help
Entry
HEAR2266          CDS       T00490                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
har  Herminiimonas arsenicoxydans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263480..2263923)
Genome map
AA seq 147 aa AA seqDB search
MTESNITRLLRGDEGEVLHAYQDHLGFWTIGVGILIDKRKGGGITPEESAYLLSNRIMGK
SIELDNRLPWWSKLDDARRGVLLSMAFQMGVDGLLGFKNTLTMVERGDYAGAAIGMLNSL
WAKQTPERSARMAEQMRTGEWKYKAGT
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatccaacattaccagactattacgcggcgacgagggcgaagtccttcatgcc
tatcaggatcatcttggcttttggacgattggggtgggaatcctgattgacaagcgcaag
ggtggtggcattactccagaagagtctgcctatctgctatcgaaccgcatcatggggaaa
agcatcgagcttgataatcgccttccatggtggagcaagttagatgacgcgcgtcgtggt
gtattgctctcgatggcgttccagatgggcgttgatggccttctcgggttcaagaacaca
ttgactatggtggagcggggcgactatgccggcgcagcaattggcatgcttaatagctta
tgggcgaagcagacgcccgaacgttctgcgcgcatggccgaacaaatgcgtactggcgaa
tggaaatacaaggcaggcacatga

DBGET integrated database retrieval system