KEGG   Herminiimonas arsenicoxydans: HEAR2367Help
Entry
HEAR2367          CDS       T00490                                 

Definition
(GenBank) putative alcohol dehydrogenase (ADH)(part 1)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00010  Glycolysis / Gluconeogenesis
har00071  Fatty acid degradation
har00350  Tyrosine metabolism
har00625  Chloroalkane and chloroalkene degradation
har00626  Naphthalene degradation
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR2367
  Lipid metabolism
   00071 Fatty acid degradation
    HEAR2367
  Amino acid metabolism
   00350 Tyrosine metabolism
    HEAR2367
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HEAR2367
   00626 Naphthalene degradation
    HEAR2367
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HEAR2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CAL62498
UniProt: A4G7L1
Position
complement(2345468..2346301)
Genome map
AA seq 277 aa AA seqDB search
MKAMVLSAAGEALQLRSVEKPVAGANDLLIRVHTCGVCRTDLHLLDAELPNAVFPIIPGH
EIVGTIVATGSAVQSFRIGDRAGVPWLGHTCGQCSYCVAGQENLCDHASFTGCTINGGYA
EYVAADSQYCFPMPGMYSNLEAAPLLCAGLIGYRALRMAAGAKRIGVYGFGAAAQIITQI
ACHQGRTVYGFTRPGDQAAQQLAYDCGVVWAGSSDEEPPSPLDAALLFAPAGELVPQALR
HVHKGGAVICAGIHMSDIPAFPYALLWGNGGFAQSPI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatggttttatctgctgccggtgaagcattgcagttacggtcggttgaaaaa
cctgttgcaggggccaatgatctgttgatcagggtacatacctgcggtgtttgcagaaca
gatctgcatctgctggatgcagagttgcccaatgccgtatttccgatcatacccgggcat
gaaatagtcggcacgatagtcgcaacaggatcggcggttcagagcttccgcatcggtgat
cgcgcaggtgtgccctggcttgggcatacctgcggccagtgttcatattgtgtcgctgga
caagaaaatctttgcgatcacgcgtctttcacgggatgcacgatcaatggcggatatgcg
gagtacgtagcggctgacagccaatactgctttcccatgccagggatgtattccaacctt
gaagcagccccattgttatgcgccgggcttatcggctatcgggcattgagaatggcagca
ggggcgaagcgcatcggcgtttacggctttggagcagcggcgcagatcatcacgcaaatc
gcttgccatcagggacgaaccgtctatggcttcacgcgccctggcgatcaagcagcgcag
cagcttgcctatgattgcggcgttgtctgggctggatccagtgatgaggaaccgccatct
ccgctggatgcggccttgctgtttgcccctgcaggagagctcgtgccgcaagccctgcgc
catgtacataaaggtggcgccgtcatctgtgccggtatccatatgagcgatattccagca
tttccgtacgcgcttctttgggggaacggcggatttgctcagtcgccaatctga

DBGET integrated database retrieval system