KEGG   Herminiimonas arsenicoxydans: HEAR2477Help
Entry
HEAR2477          CDS       T00490                                 

Definition
Guanyl-specific ribonuclease St (RNase St) (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
har  Herminiimonas arsenicoxydans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2449574..2449948)
Genome map
AA seq 124 aa AA seqDB search
MKVKLITRFSLFFATLLLSYNAFAFDSGALGIVQATDLPPEARQTIALIRQGGPFPYEKD
GSVFGNYEKILPQQRRGYYREYTVKTPRTRNRGARRIITGGEKNRPHEYYYTADHYRSFK
RVIE
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttaaattaatcacacgtttttccctgtttttcgctacattattactttcctac
aacgcttttgcctttgattccggcgcattgggaatcgtgcaagcgacggacttgccgccg
gaggcgcgacaaactattgcgttgattcgacagggcggccctttcccgtatgagaaggac
ggctccgtgttcggcaactatgaaaagattttgccgcaacaaaggcgtgggtattatcgc
gaatacaccgtgaaaacgccgcgtacccgcaatcggggcgcaaggcggattattactggc
ggtgaaaaaaacaggcctcacgaatattattacaccgctgatcactacagaagtttcaaa
cgggtcatagagtga

DBGET integrated database retrieval system