KEGG   Herminiimonas arsenicoxydans: HEAR2721Help
Entry
HEAR2721          CDS       T00490                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR2721 (algC)
   00030 Pentose phosphate pathway
    HEAR2721 (algC)
   00051 Fructose and mannose metabolism
    HEAR2721 (algC)
   00052 Galactose metabolism
    HEAR2721 (algC)
   00500 Starch and sucrose metabolism
    HEAR2721 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HEAR2721 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HEAR2721 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HEAR2721 (algC)
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HEAR2721 (algC)
    5.4.2.8  phosphomannomutase
     HEAR2721 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690788..2692164)
Genome map
AA seq 458 aa AA seqDB search
MLTLSQSIFKAYDIRGVIGSTLDADVARAIGRAFGSAVRAKGEQVVVIGRDGRLSGPELA
AALAEGLQAAGLDVVDLGVVATPMLYLGTHVLDAQSGIMVTGSHNPPDYNGFKMVLAGEA
IYGDTIQALYQAIINKEFSEGAGSYRTYDIADAYQQRIAGDVKLARPMKIAIDCGNGVAG
AFAGALYRALGCEVIELFCEVDGTFPNHHPDPAHPENLQDLIRCLQQTDAEIGLAFDGDG
DRLGVVTKDGQIIYPDRQLMLFAQDVLTRHPGEQILYDVKCTRHLAPWIAERGGKPLMWK
TGHSLVKAKMRETGAPLGGEMSGHIFFKDRWYGFDDGMYAGARMLELLSREKDPSAVLNA
LPQSVSTPELQLQLKEGESFPLIAKLQSEAQFPGSDQIITIDGLRVEYPDGFGLARSSNT
TPVIVMRFEAESQQGLQRIQAEFKRVITAAKPDAVMPY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctgactctctcgcaaagtattttcaaggcttacgatattcgtggtgtcatcggttcc
acgctggatgccgatgtggcgcgcgcgataggccgtgcgtttggtagcgcggtgcgggcc
aagggcgagcaggtcgtggtgatcgggcgcgatggacgcttgtccggtcctgaactggcg
gcagcgctggccgaaggtttgcaggcggcaggcctggatgtggtcgatctcggtgtggtc
gccacgcccatgctgtacctcggcacacatgtgctggatgcgcaatccggcatcatggtg
accggcagccataatccgcccgactacaacggtttcaagatggtgctggcaggcgaagcg
atttacggcgacacgatccaggccttgtatcaggccatcatcaacaaggaattcagcgag
ggcgcaggcagttatcgcacttacgatattgcagacgcctatcagcagcgcattgcgggc
gacgtcaaactggcgcgtccgatgaagatagcgattgattgcggcaacggcgtggcggga
gcctttgccggcgctttgtaccgcgcactcggttgcgaagtcatcgaattgttttgcgag
gtggatggcactttcccgaatcatcatcccgatccggcgcatccggaaaatctgcaggac
ctgatacgctgcctgcagcagacggatgccgaaatcggcctggctttcgatggcgacggc
gatcgcctcggtgtggtgaccaaggatggacaaatcatttatccggatcggcaattgatg
ctgtttgcacaggatgtattgacgcgccatccgggcgaacaaattctgtacgacgtcaaa
tgcacgcgtcatctggcaccgtggattgccgaacgtggtggcaagccgctgatgtggaag
accggccattcgctggtcaaggcaaaaatgcgtgaaaccggcgccccgctgggcggcgag
atgagcggccatattttcttcaaggatagatggtacggttttgatgacggcatgtatgcc
ggtgcgcgcatgctggaattgctgagtcgtgaaaaagatccgtcggctgtgctgaatgcc
ttgccacaatcggtcagcacgccggaactgcaattgcagttgaaggagggagagagtttt
ccactgattgccaaactgcagagcgaggcgcaatttcccggttccgatcagatcatcaca
atagacggcctgcgcgtcgaatatccggacggcttcggtctggcgcgttcgtcgaatacc
acgccggtgatcgtgatgcgcttcgaggcggagtcgcagcagggcttgcagcgtattcag
gcagaattcaagcgcgtcattacggcggcaaagccggatgccgtcatgccttactga

DBGET integrated database retrieval system