KEGG   Herminiimonas arsenicoxydans: HEAR2721Help
Entry
HEAR2721          CDS       T00490                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00010  Glycolysis / Gluconeogenesis
har00030  Pentose phosphate pathway
har00051  Fructose and mannose metabolism
har00052  Galactose metabolism
har00230  Purine metabolism
har00500  Starch and sucrose metabolism
har00520  Amino sugar and nucleotide sugar metabolism
har00521  Streptomycin biosynthesis
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR2721
   00030 Pentose phosphate pathway
    HEAR2721
   00051 Fructose and mannose metabolism
    HEAR2721
   00052 Galactose metabolism
    HEAR2721
   00500 Starch and sucrose metabolism
    HEAR2721
   00520 Amino sugar and nucleotide sugar metabolism
    HEAR2721
  Nucleotide metabolism
   00230 Purine metabolism
    HEAR2721
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HEAR2721
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HEAR2721
    5.4.2.8  phosphomannomutase
     HEAR2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAL62841
UniProt: A4G8K4
Position
complement(2690788..2692164)
Genome map
AA seq 458 aa AA seqDB search
MLTLSQSIFKAYDIRGVIGSTLDADVARAIGRAFGSAVRAKGEQVVVIGRDGRLSGPELA
AALAEGLQAAGLDVVDLGVVATPMLYLGTHVLDAQSGIMVTGSHNPPDYNGFKMVLAGEA
IYGDTIQALYQAIINKEFSEGAGSYRTYDIADAYQQRIAGDVKLARPMKIAIDCGNGVAG
AFAGALYRALGCEVIELFCEVDGTFPNHHPDPAHPENLQDLIRCLQQTDAEIGLAFDGDG
DRLGVVTKDGQIIYPDRQLMLFAQDVLTRHPGEQILYDVKCTRHLAPWIAERGGKPLMWK
TGHSLVKAKMRETGAPLGGEMSGHIFFKDRWYGFDDGMYAGARMLELLSREKDPSAVLNA
LPQSVSTPELQLQLKEGESFPLIAKLQSEAQFPGSDQIITIDGLRVEYPDGFGLARSSNT
TPVIVMRFEAESQQGLQRIQAEFKRVITAAKPDAVMPY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctgactctctcgcaaagtattttcaaggcttacgatattcgtggtgtcatcggttcc
acgctggatgccgatgtggcgcgcgcgataggccgtgcgtttggtagcgcggtgcgggcc
aagggcgagcaggtcgtggtgatcgggcgcgatggacgcttgtccggtcctgaactggcg
gcagcgctggccgaaggtttgcaggcggcaggcctggatgtggtcgatctcggtgtggtc
gccacgcccatgctgtacctcggcacacatgtgctggatgcgcaatccggcatcatggtg
accggcagccataatccgcccgactacaacggtttcaagatggtgctggcaggcgaagcg
atttacggcgacacgatccaggccttgtatcaggccatcatcaacaaggaattcagcgag
ggcgcaggcagttatcgcacttacgatattgcagacgcctatcagcagcgcattgcgggc
gacgtcaaactggcgcgtccgatgaagatagcgattgattgcggcaacggcgtggcggga
gcctttgccggcgctttgtaccgcgcactcggttgcgaagtcatcgaattgttttgcgag
gtggatggcactttcccgaatcatcatcccgatccggcgcatccggaaaatctgcaggac
ctgatacgctgcctgcagcagacggatgccgaaatcggcctggctttcgatggcgacggc
gatcgcctcggtgtggtgaccaaggatggacaaatcatttatccggatcggcaattgatg
ctgtttgcacaggatgtattgacgcgccatccgggcgaacaaattctgtacgacgtcaaa
tgcacgcgtcatctggcaccgtggattgccgaacgtggtggcaagccgctgatgtggaag
accggccattcgctggtcaaggcaaaaatgcgtgaaaccggcgccccgctgggcggcgag
atgagcggccatattttcttcaaggatagatggtacggttttgatgacggcatgtatgcc
ggtgcgcgcatgctggaattgctgagtcgtgaaaaagatccgtcggctgtgctgaatgcc
ttgccacaatcggtcagcacgccggaactgcaattgcagttgaaggagggagagagtttt
ccactgattgccaaactgcagagcgaggcgcaatttcccggttccgatcagatcatcaca
atagacggcctgcgcgtcgaatatccggacggcttcggtctggcgcgttcgtcgaatacc
acgccggtgatcgtgatgcgcttcgaggcggagtcgcagcagggcttgcagcgtattcag
gcagaattcaagcgcgtcattacggcggcaaagccggatgccgtcatgccttactga

DBGET integrated database retrieval system