KEGG   Herminiimonas arsenicoxydans: HEAR2975Help
Entry
HEAR2975          CDS       T00490                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HEAR2975 (gpmA)
   01230 Biosynthesis of amino acids
    HEAR2975 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR2975 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HEAR2975 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR2975 (gpmA)
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HEAR2975 (gpmA)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HEAR2975 (gpmA)
  Exosomal proteins of melanoma cells
   HEAR2975 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2940174..2940920
Genome map
AA seq 248 aa AA seqDB search
MYKIVLMRHGESTWNLDNRFTGWADVDLTEKGCAEAKHAGKLLRDAGFTFDLAYSSVLKR
AIRTMWITLDEMDLMWIPVVCDWHLNERHYGALQGMNKAETASKYGADQVLQWRRSYDTP
PKLLAEDDPRTMYKDPRYATLKREEIPLGECLKDTLLRVEPYWNDTIVPSIRAGRQIIIS
AHGNSLRALIKILDDISDQDIVSLSIPNGRPIVYELDDNLKPIRHYYLGDQESLAAAVQA
AASHGPVP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatcgtattgatgcgccacggcgagtccacatggaacctcgataatcgcttt
accggctgggccgatgtcgatttgactgaaaaaggttgtgctgaagcaaagcacgccggc
aaattgctgcgcgatgcaggatttaccttcgacctggcttattcatccgtgctgaaacgc
gccatccgcaccatgtggatcacgctggacgaaatggatctgatgtggatacccgtcgtc
tgcgactggcacctgaacgaacgccattacggcgcgctgcagggcatgaacaaggctgaa
accgccagcaaatacggcgccgaccaagtcttgcaatggcgtcgtagctacgacacccct
cccaaactgctggctgaggacgatccgcgcaccatgtacaaggatccgcgctatgccacc
ctgaagcgtgaagaaattccgcttggcgaatgcctgaaagacacgctgctgcgtgtggaa
ccgtactggaacgacaccatcgtgccatccatacgggccggcaggcagatcatcatctcg
gcgcacggcaacagcctgcgcgccctgatcaagatactcgacgacatcagcgatcaggat
attgtttcgctgagcatcccgaacggccgccctatcgtgtatgaactggatgacaatctg
aaacccatccgtcattactacctgggtgatcaggaatcgctggcagcagccgtccaggcg
gccgccagccacggaccagtgccataa

DBGET integrated database retrieval system