KEGG   Herminiimonas arsenicoxydans: HEAR3207Help
Entry
HEAR3207          CDS       T00490                                 

Gene name
arsC
Definition
arsenate reductase (EC:1.20.4.1)
Orthology
K03741  
arsenate reductase [EC:1.20.4.1]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     HEAR3207 (arsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167176..3167682
Genome map
AA seq 168 aa AA seqDB search
MSNQPFNVLFLCTGNSARSIMAEALISTMGKGQFKGYSAGSNPNGIVNPFTIEQVNKTGY
STDNLRSKSWDEFAAPDAPHMDFIITVCDNAAGEVCPIWPGHPTSAHWGFEDPAAVEGTD
EEKRAAFERIFKQIMARMNAFVSLPHNMLEKHAIHQEIQKIGATPVSD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaaccgttcaatgtcttgtttctctgtaccggtaactccgcccgttccatc
atggccgaagcacttatatccacgatgggtaaaggccaatttaaaggctatagcgcgggt
agcaacccgaatggcatcgttaatccattcacgattgaacaggtaaataagaccggctac
tcgactgataatttgcgtagcaaaagttgggacgagttcgcggctcccgacgcgccacac
atggacttcatcattactgtttgtgacaacgcagctggagaggtatgccctatctggcca
ggtcatccaacatcagctcactggggttttgaagaccctgcggcagtggaaggtactgat
gaagaaaagcgtgccgcctttgagcgtatcttcaagcaaatcatggcgcgcatgaatgcc
tttgtcagcttgccgcacaacatgttggagaaacatgccatccatcaggaaatccagaaa
attggtgctacaccggtttctgactaa

DBGET integrated database retrieval system