KEGG   Herminiimonas arsenicoxydans: HEAR3261Help
Entry
HEAR3261          CDS       T00490                                 

Definition
phosphoglyceromutase 1, gpmA-like (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
har  Herminiimonas arsenicoxydans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HEAR3261
   01230 Biosynthesis of amino acids
    HEAR3261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR3261
  Energy metabolism
   00680 Methane metabolism
    HEAR3261
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR3261
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HEAR3261
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HEAR3261
  Exosomal proteins of melanoma cells
   HEAR3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3221043..3221762)
Genome map
AA seq 239 aa AA seqDB search
MGNLVIVRHGESQWNRENRFTGWTDIDLTANGIQQARNAGRALAEAGFRFDLALTSMLKR
TIRSQWLMLDEMDAMYIPIISHWRLNERHYGALTGQNRAETIARFGEEQVWKWRRGFDSQ
PPLMDADDPRAPWREPRYQGIPRDSLPLGESLKETVERVRVFWDEVIVPALKQDKNVIIS
SHGNSQRALVKLLEDMSEEEVARFDVPNSVPLVYKLDTGLRVLSRSSMSIPHPEVSAIL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatctggtgattgttcgccatggcgaatcacagtggaacagggaaaaccgcttt
accggctggaccgatatcgatttgaccgccaatggtattcaacaggcacgcaatgccggt
cgcgcgctggccgaagccgggttccgcttcgaccttgccctcacctccatgctgaaaaga
accatccgttcacagtggttgatgctggacgagatggatgcgatgtatatccctatcatc
agtcactggcgccttaatgagcggcattacggcgcactgaccggtcagaaccgcgcggaa
accatcgccagatttggcgaagaacaagtgtggaaatggcggcgcggcttcgacagccag
ccgccgctgatggatgcagacgatccgcgcgcaccgtggcgcgagccgcgttatcagggt
attccgcgcgactctctgccgctcggcgaatcgctgaaggaaaccgtggagcgcgtgcgc
gtattctgggatgaggtcatcgtaccggccttgaagcaggacaagaacgtgatcatttcc
tcgcatggcaatagtcagcgcgcgctggttaagctgctggaagatatgtcggaggaagaa
gtggcgcgcttcgatgtgccgaacagcgtgccgctggtatacaaactggataccggcttg
cgggtgctgtcccgcagttcgatgagtattccgcacccggaagtgtcggcgatactttaa

DBGET integrated database retrieval system