KEGG   Halanaerobium hydrogeniformans: Halsa_0009Help
Entry
Halsa_0009        CDS       T01349                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:has00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16342..17838
Genome map
AA seq 498 aa AA seqDB search
MENYVLAIDQGTTSSRAMIFDHDGQVVSVAQKEFTQYFPKPGWVEHDPDEIWGTTLGVIA
DALGKKNIKPSQIISIGITNQRETTVVWDAETGEPIHNAIVWQDRRTASICDDLKDAGHE
QTIKDKTGLVVDAYFSGTKIKWMLDNVEGAREKADAGKLRFGTIDTWLIWKLTGGNVHVT
DYTNASRTLIYNIKELKWDDELLGFLDVPRSMLPEVKASSEVYGNTVDFHFFGEEVPIAG
IAGDQQAATFGQVCYEKGMAKNTYGTGCFMLMNTGEEAVASENGLLTTIAYGIDGKVNYA
LEGSIFIAGAAIQWLRDELKIIDKAPDSEYFANKVEDTGGVYVVPAFAGLGAPYWDMYAR
GTIVGLTRGTSKEHLIRATLESIAYQTRDVLEAMEADSGIELKTLRVDGGAAMNDFLMNF
QADILGVEVERPKVNETTALGAAYLAGLAVGFWDNKEELVAKWDRDALFVPKMAEEKKEK
LYAGWKKAVERAKDWSDE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaattatgtcttagcgattgatcaaggaactactagttcacgggcaatgatattt
gatcatgatgggcaagttgttagtgtagctcaaaaagaatttacacagtacttcccaaaa
cctggttgggtagaacatgatccagatgaaatttggggtacaacattaggtgttattgct
gatgctttaggtaagaaaaatattaaaccttctcaaatcatctcaattggtatcacaaat
cagcgtgaaacaacagttgtttgggatgctgaaactggagaacctatccataatgctatc
gtttggcaggatagaagaaccgcttcaatttgtgatgacttaaaagacgcaggtcatgaa
caaactattaaagacaaaactggtcttgttgtagatgcttatttctcaggtacaaaaatt
aaatggatgcttgacaatgtagaaggcgctagagaaaaagcagatgctggcaaacttaga
tttggtacaattgatacctggttaatctggaaacttacaggtggaaatgtacatgttact
gattatactaatgcttcacgtacattaatttataacattaaagaacttaaatgggacgat
gaattattaggtttcttagatgtacctcgttcaatgcttccagaagttaaagcttcaagt
gaagtttatggtaatacagttgacttccatttcttcggcgaagaagtaccaattgctggt
attgctggagatcaacaggcagctacatttggtcaggtatgttatgaaaaaggtatggct
aagaatacttatggtacaggttgctttatgctcatgaatactggtgaagaagcagttgca
tctgaaaatggattattaactacaattgcttatggtattgatggtaaagttaactatgca
cttgaaggttctatctttattgctggtgcagctattcagtggttaagagacgaattgaaa
ataatagataaagctcctgattcagaatactttgctaataaagttgaagacactggtgga
gtttatgtagtacctgcttttgctggtttaggtgctccatactgggatatgtatgcacgt
ggtacaattgttggattaacaagaggtacttctaaagaacatttaatccgtgcaacatta
gaatctattgcttatcaaacaagagatgtattggaagctatggaagcagattctggcata
gaacttaagactcttcgtgtagacggtggagctgctatgaatgacttcttaatgaacttc
caggcagatatccttggtgttgaagtagaaagaccaaaagttaatgaaactactgcttta
ggtgctgcttatcttgctggtttagctgttggattctgggacaacaaagaagagctcgtt
gctaagtgggatagagatgctttatttgttcctaagatggctgaagagaagaaagaaaaa
ttatatgcaggctggaaaaaagctgtagaaagagcaaaagattggtctgacgaataa

DBGET integrated database retrieval system