KEGG   Halanaerobium hydrogeniformans: Halsa_0175Help
Entry
Halsa_0175        CDS       T01349                                 

Definition
succinate-semialdehyde dehydrogenase (NAD(P)+)
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_0175
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Halsa_0175
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     Halsa_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
196670..198031
Genome map
AA seq 453 aa AA seqDB search
MSTTIQAMVEKSKKAQKEFENNFGQEEVDQIIKDITKLVYDRAEEFAKMIHEETGMGVYE
DKVKKHLGKSKIMWKGLKGRKSMGIIERDEEKGTVTFAKPVGVVASLSPVTNPVVTAMNN
IVNAIKGKNSIIVSSHPASLNSVVYSIDLFNDILSSYNAPENLVQIIKEPSIEKTNELMA
ACDVVVATGGHAMVKAAYGSGRPSYGVGQGNVQCIVDRDADLNEAVKTIIKGRIFDNGII
CSGEQTSILPAEMYNEAIEIFKENDVYYVEDDEEKAKLTELLFPEGHLNKKMVGQPAKDI
AAEVGIDVPEDTVMLLIKGDKEDKEDLLRKEKIFPVNVAYSYDDLDEAIDIAQTNLAIEG
IGHSVSVHSHNEENIEKIAAAVKVSRVIVNAACSLTVGGSFTNGLEPTTTLGCGTWGNNS
ISENFYFKHLLNTTKIAYLLEDVEVPTDEEFWA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtactactattcaagcaatggtagaaaaatctaaaaaagcacaaaaggaatttgaa
aataacttcgggcaggaagaagtagatcaaataattaaagatatcacaaaattagtatat
gacagagcagaagaatttgcgaaaatgattcatgaagaaaccggtatgggtgtttatgaa
gataaagttaaaaaacatttaggaaaatctaaaatcatgtggaaaggtcttaaaggaaga
aaatcgatggggataatcgaaagagatgaagaaaagggaacagttactttcgccaaacct
gttggggttgttgcctcacttagtccggtaactaatcctgttgtaactgcgatgaacaat
atcgtgaatgcaattaaaggcaaaaattccattattgtttcttctcaccctgcttcttta
aattccgttgtttattcaattgatctttttaatgatattttaagcagctataatgcacct
gaaaatctagtgcaaattattaaagaaccttctatagagaaaaccaatgaactgatggca
gcctgtgatgttgttgtagcaactggtggtcatgctatggttaaagctgcttatggtagt
ggtagaccatcttatggtgtaggccagggtaatgtacagtgtattgtggatagagatgct
gatcttaatgaagctgttaaaactattataaagggaagaatatttgataatgggatcatc
tgttctggagaacagacttctattctccctgccgaaatgtataatgaagcaattgaaata
tttaaagaaaatgatgtttattatgtagaagatgatgaagaaaaagctaaattaactgaa
cttttattccctgaaggtcatcttaataaaaaaatggttggtcagcctgccaaagatata
gcagcagaagtaggaattgatgttcccgaagatactgtaatgctcttaattaagggagat
aaagaagataaagaagatctattaagaaaagagaaaattttccctgtaaatgttgcttat
agctatgatgatttagatgaagcaatcgatatagcccaaactaaccttgcaatagaaggt
atagggcacagtgtatctgttcattcacacaatgaggaaaatatagaaaaaattgcagca
gcagttaaagtttcaagagtaattgttaatgcagcctgttcacttacagttggaggtagc
tttacaaacggtttagaacctactactacacttggttgtggaacctggggtaataacagt
atatcagagaacttttatttcaaacatctcttaaatacaactaaaatagcttatttactt
gaagatgtagaagttccaacagatgaagagttctgggcataa

DBGET integrated database retrieval system