KEGG   Halanaerobium hydrogeniformans: Halsa_0176Help
Entry
Halsa_0176        CDS       T01349                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00020  Citrate cycle (TCA cycle)
has00640  Propanoate metabolism
has00660  C5-Branched dibasic acid metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halsa_0176
   00640 Propanoate metabolism
    Halsa_0176
   00660 C5-Branched dibasic acid metabolism
    Halsa_0176
Enzymes [BR:has01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Halsa_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADQ13665
UniProt: E4RNX5
Position
198062..199243
Genome map
AA seq 393 aa AA seqDB search
MKLLEYKSMELFYDYNIPSNKGVVIDSLADLDNTQQDDEPTRGSNVGAEIENYPVVVKAQ
VQTGGRGKAGGIKFADNAEEVKQISKDLLGSEIKGLEIKKLFVVDMIDVKKEWYLSITLD
RKTKTPLLIFSTEGGVDIEETAHETPEKIAKIPINPMMGIKAYMLRYLINYFDVDPKYLK
ELTELVENLYKLFREYDCLLAEINPLVITENEELLALDGKIDIDDNSLFRHDDILKFRDE
LTEDAKVIEAREYDFLYIPIRDTGNIGVISNGSGMIMSSMDLISQRGMEVTCALDLGGGA
TAERVKEAIKIVLSNDDVEVLLINIFGGITRCDEIANGLKMAADAVGDKKVIIRVEGTNK
EAGLDIIHGMKDTVVSADSILEGVEKLYEHFSG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactattagaatataaatcaatggaattgttctatgattataatattccttcaaat
aagggagttgttattgattcccttgcagatttagataatacacaacaggatgatgaacct
actcgaggtagtaatgttggtgcagaaattgaaaattatcctgtagttgtaaaggcccag
gtgcagaccggtggccgaggtaaagctggaggaattaaatttgcagataatgctgaagag
gtaaaacaaatcagcaaagatttacttggtagtgaaattaaaggcttagaaattaaaaaa
ctttttgttgtagatatgattgatgtaaaaaaagaatggtatttaagtataacccttgac
cgcaaaacaaaaactcctttacttatctttagtaccgaaggtggagtagatatcgaggaa
accgctcacgaaacaccagaaaaaatcgcaaaaataccgataaatccaatgatgggtatt
aaagcatatatgttgagatatctgatcaattattttgatgttgatccaaaatatttaaaa
gagcttactgagttagtagaaaatctctataaattatttagagaatatgattgtctgctt
gcagaaataaatccacttgtaatcaccgaaaatgaagaacttttagcactagacggtaaa
attgatattgatgataattcactcttcagacatgatgatattttgaagtttagagatgaa
cttactgaagatgcaaaagtaattgaagcaagagaatatgattttctctatataccgatc
agggatactggaaacataggtgttataagtaatggttctggtatgataatgtcatctatg
gatttaatttctcaaagaggtatggaagtaacctgtgcactcgaccttggtgggggagca
acagcagaaagagttaaagaagcgattaaaattgtgctctcaaatgatgatgtagaagtg
ctgttaataaatatttttggtggaattacccgctgtgatgaaattgctaatggattaaag
atggcagctgatgcagtaggagacaaaaaggtaattattagagttgaaggaactaacaaa
gaagcaggactagatataattcatggtatgaaggatactgttgtttctgctgacagcata
ctggaaggagtggagaaattatatgagcattttagtggatga

DBGET integrated database retrieval system