KEGG   Halanaerobium hydrogeniformans: Halsa_0179Help
Entry
Halsa_0179        CDS       T01349                                 

Definition
malic protein NAD-binding protein
Orthology
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Pyruvate metabolism
Carbon metabolism
Two-component system
Class
Metabolism; Overview; Carbon metabolism [PATH:has01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:has00620]
Environmental Information Processing; Signal transduction; Two-component system [PATH:has02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201755..202981
Genome map
AA seq 408 aa AA seqDB search
MNLKEEALKMHKDNQGKLMVQTKVAVNDEHDLSLAYSPGVAEPCLEIERNPNTIFDYTNK
ANFVAVVTDGSAVLGLGDIGAAASMPVMEGKAVLFKEFGGVDAFPICLDESDPDKLIEIV
KKMESVWGGINLEDIKAPKCFYIEERLKEELDIPVFHDDQHGTAIITLAGLINSLKIVDK
KIEDIKVVVNGAGAAGVSIIDLLIAEGVEDIIALDSKGAIYEGRDRLNDSKKELAKITNK
NNKSGDLAEIMKGTDVFIGVSIANLVSKEMVRSMNTDPIIFAMANPVPEIMPEDAFEAGA
KIVGTGRSDYPNQVNNVLAFPGIFRGALDVRAREINRKMKQAAAYALADLIAEDELEADY
VIPKPFDPRVGPYVAAAVAQAAIDTNAARIKLSYEEELEKAKKIMKKK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaagaagaagccctaaaaatgcataaagataatcaaggtaaattaatggtt
caaacaaaggttgcagttaatgatgagcatgacctttctttagcttattctccgggagtt
gccgaaccctgtttagaaatagaaagaaatccaaatactatttttgattatacaaataaa
gcaaattttgttgctgtagtcaccgatggtagtgcagttttgggattaggagatattgga
gctgcagcatcaatgcctgtcatggaaggtaaggcagtattgtttaaagaattcggtgga
gtagatgccttcccgatctgtcttgatgaatctgatccagataaactgatagagatagtt
aaaaagatggaatctgtctggggtggaatcaacttagaagatataaaagcaccaaagtgt
ttctatattgaagaaaggttaaaagaagaacttgatattcccgtatttcatgatgaccag
cacggtacagcaattattacactggccgggcttatcaattcattgaagatagttgataag
aaaattgaggatatcaaggtagtagttaatggagctggagctgcaggagtaagtattatt
gatcttcttattgctgaaggggtagaagatattatagcacttgatagtaaaggtgcgatt
tatgaaggcagagatagattaaatgacagcaaaaaagagctggctaaaataaccaataaa
aacaataaatcaggggaccttgcagagataatgaaagggacagatgtctttattggagtt
tcaatagcgaaccttgtttcaaaagagatggtaagatcaatgaatacagatccgataatt
tttgcaatggcaaatccagttccagaaataatgccggaagatgcatttgaagccggagca
aagatagtaggtacaggaagatcagattatcccaatcaggtaaacaatgtattggcattt
ccgggtatttttaggggagcactggatgtaagggctagagaaattaatagaaagatgaag
caggcggctgcttatgcattagcagacttaattgctgaagatgagttagaagcagattat
gtaataccaaaaccatttgatccgagagttggaccatatgtggcagcagcagtagcccag
gcagcaatagatacaaatgctgcaagaataaagttgagttatgaagaggaattagaaaaa
gccaaaaagataatgaagaaaaaataa

DBGET integrated database retrieval system