KEGG   Halanaerobium hydrogeniformans: Halsa_0309Help
Entry
Halsa_0309        CDS       T01349                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:has01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:has01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:has00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:has00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:has00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:has00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:has00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
366376..367602
Genome map
AA seq 408 aa AA seqDB search
MKKRNCLLGQSGGPTAVINSSYRGILDQVKKSADLDRIYAMRFGLQGLLAGKYFDLTEKS
EKELELLQNTPSTVIGTSRYKIDHYDENEEDYIKFFNFLEEHQIAYVFYVGGNDSMDTVA
KLTSYAEEKGIDVRIMGIPKTIDNDIVITDHCPGFGSAAKYIATSVMEIARDSRVYDLKN
VHIIETMGRSSGWLAAASILAANEKLYAPDFIYLPEAVFSIDKFFADVEKKMKEQKAITV
VVSEGIKDKNGEYISAGKSTAHDQFGHKKLGGAAYTLKPIIKENLCNRVKAIKFDVMQRA
AAHCASGRDIVEAYQVGAEAVKAALAGETGKMTAIKRISNDPYQVEIIKVEAEKVANQVK
LVPDKWINEDHNGVTEGFKDYVLPLIQGDIDMETENSLPVFSELETGQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaaattgtttgcttggacaatcaggtggacctacagcagtaattaattcc
agttatagaggtattctcgaccaggtaaaaaaatcagcagatttagataggatttatgcg
atgaggttcggtttgcagggtcttctagcagggaaatattttgatcttacagaaaaaagt
gaaaaggaattagaattattacagaacaccccatctaccgtaatcggtacttccaggtat
aagatcgatcattatgatgaaaatgaagaggattatattaagttttttaactttttagaa
gagcatcaaatagcttatgtgttttatgttggtggtaatgattcgatggatactgtagca
aagttgaccagttatgctgaagaaaaaggaattgatgttaggataatgggtatccccaaa
acaattgataatgatatagtaataacagaccactgtcctggctttggtagtgcagccaaa
tatattgcaacttccgttatggaaattgccagagacagcagggtctatgatcttaaaaac
gttcatatcatcgaaacaatgggccgcagtagtggctggctggcagctgcaagtatttta
gcagccaacgaaaaattatatgctccagattttatctatctacctgaggcagtatttagc
atcgataagttctttgcagatgttgaaaagaaaatgaaagaacagaaggcgataacagtc
gttgtatcagagggtatcaaagataaaaatggagaatatatttcggcaggtaaaagtacc
gcccatgatcagtttgggcataaaaaacttggtggagcagcttatactttaaaacctatt
ataaaagagaatctctgtaatcgggttaaggcaatcaagtttgatgttatgcagagggca
gcagcccactgtgcttctggtagagatatagtggaagcctatcaggttggtgcagaagct
gtaaaagctgctctggctggtgaaaccggtaaaatgacagcaattaaaagaatctccaat
gatccctaccaggtagagataataaaagttgaggctgagaaagtagccaatcaggtaaaa
ttagtgcctgataaatggattaatgaagatcataatggggtaacagaaggatttaaagat
tatgttttacccttaattcaaggtgatatagatatggagacagagaactcattacctgta
ttttcagaactggaaactgggcaataa

DBGET integrated database retrieval system