KEGG   Halanaerobium hydrogeniformans: Halsa_0309Help
Entry
Halsa_0309        CDS       T01349                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_0309
   01230 Biosynthesis of amino acids
    Halsa_0309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0309
   00030 Pentose phosphate pathway
    Halsa_0309
   00051 Fructose and mannose metabolism
    Halsa_0309
   00052 Galactose metabolism
    Halsa_0309
  Energy metabolism
   00680 Methane metabolism
    Halsa_0309
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halsa_0309
Protein phosphatases and associated proteins [BR:has01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Halsa_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
366376..367602
Genome map
AA seq 408 aa AA seqDB search
MKKRNCLLGQSGGPTAVINSSYRGILDQVKKSADLDRIYAMRFGLQGLLAGKYFDLTEKS
EKELELLQNTPSTVIGTSRYKIDHYDENEEDYIKFFNFLEEHQIAYVFYVGGNDSMDTVA
KLTSYAEEKGIDVRIMGIPKTIDNDIVITDHCPGFGSAAKYIATSVMEIARDSRVYDLKN
VHIIETMGRSSGWLAAASILAANEKLYAPDFIYLPEAVFSIDKFFADVEKKMKEQKAITV
VVSEGIKDKNGEYISAGKSTAHDQFGHKKLGGAAYTLKPIIKENLCNRVKAIKFDVMQRA
AAHCASGRDIVEAYQVGAEAVKAALAGETGKMTAIKRISNDPYQVEIIKVEAEKVANQVK
LVPDKWINEDHNGVTEGFKDYVLPLIQGDIDMETENSLPVFSELETGQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaaattgtttgcttggacaatcaggtggacctacagcagtaattaattcc
agttatagaggtattctcgaccaggtaaaaaaatcagcagatttagataggatttatgcg
atgaggttcggtttgcagggtcttctagcagggaaatattttgatcttacagaaaaaagt
gaaaaggaattagaattattacagaacaccccatctaccgtaatcggtacttccaggtat
aagatcgatcattatgatgaaaatgaagaggattatattaagttttttaactttttagaa
gagcatcaaatagcttatgtgttttatgttggtggtaatgattcgatggatactgtagca
aagttgaccagttatgctgaagaaaaaggaattgatgttaggataatgggtatccccaaa
acaattgataatgatatagtaataacagaccactgtcctggctttggtagtgcagccaaa
tatattgcaacttccgttatggaaattgccagagacagcagggtctatgatcttaaaaac
gttcatatcatcgaaacaatgggccgcagtagtggctggctggcagctgcaagtatttta
gcagccaacgaaaaattatatgctccagattttatctatctacctgaggcagtatttagc
atcgataagttctttgcagatgttgaaaagaaaatgaaagaacagaaggcgataacagtc
gttgtatcagagggtatcaaagataaaaatggagaatatatttcggcaggtaaaagtacc
gcccatgatcagtttgggcataaaaaacttggtggagcagcttatactttaaaacctatt
ataaaagagaatctctgtaatcgggttaaggcaatcaagtttgatgttatgcagagggca
gcagcccactgtgcttctggtagagatatagtggaagcctatcaggttggtgcagaagct
gtaaaagctgctctggctggtgaaaccggtaaaatgacagcaattaaaagaatctccaat
gatccctaccaggtagagataataaaagttgaggctgagaaagtagccaatcaggtaaaa
ttagtgcctgataaatggattaatgaagatcataatggggtaacagaaggatttaaagat
tatgttttacccttaattcaaggtgatatagatatggagacagagaactcattacctgta
ttttcagaactggaaactgggcaataa

DBGET integrated database retrieval system