KEGG   Halanaerobium hydrogeniformans: Halsa_0353Help
Entry
Halsa_0353        CDS       T01349                                 

Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:has00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
412135..413268
Genome map
AA seq 377 aa AA seqDB search
MLKKLEKSKRPVWVEIDLNNLKFNIKEIKKTLNSDTIFTAVVKADGYGHGAVPTAEAAIE
AGADRLAVAIPEEGIELREAGIAAPIEILGELLPEQLPELIRYDLIPTISKFKTAERLNN
LCAGYNLKKKIHLNIDTGMNRVGVNYKKALPLLKKITELPNLEIEGIMTHFARADELEKE
YTLIQWERFNQLIEKLEAENIEIPIKHCANSAAVIDFPEFALDMVRAGIMIYGLKPSPDL
KNNFNLKAVLSWKSRIVRLKDVPAGEGISYGSEYITPKREKIATIPLGYADGYARILGNK
ASVLVKGKRAPIRGRICMDQFMVDVSGIEGVKVGDEVVLIGSQNGLSLSADKLAEQAGTI
NYEIVSRISKRVARIYK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaagcttgaaaaatcaaaaagaccggtctgggttgaaatagatttaaataat
ttaaaatttaatatcaaagaaataaaaaagactttaaattcagatacaatttttacagca
gttgttaaagcagatggttatggtcatggtgctgtcccgactgcagaggctgctatagaa
gcgggagctgataggctggcagttgctattccagaagagggaatagaattaagagaggca
gggattgctgctccaatcgagatcctgggagaattactacctgaacagttacctgagttg
attagatatgatttaatccccacaatctctaaatttaagacggcagagcggttaaataac
ctgtgtgctggctacaatctgaagaaaaaaattcatctgaatatagatacagggatgaac
agggttggggttaattataaaaaagcactgccactgctaaaaaaaataactgagcttccc
aatctcgaaatagagggtataatgacccattttgcccgggcagatgaacttgaaaaagaa
tatacattaatacagtgggagcggtttaatcaattaatagagaaattagaagcagaaaat
attgaaatccccatcaagcactgtgctaatagtgcagcagtaattgattttccagaattt
gctctggatatggttagagcggggatcatgatttatggtttaaagccatccccagattta
aaaaacaattttaatttaaaggctgttttaagttggaagagtagaatagttagattaaaa
gatgttcctgctggtgagggaatcagttatggttcagaatatattactcccaaaagagaa
aaaatagctaccattcctttaggttatgctgatggttatgcccggatactgggtaataag
gcaagtgttttagttaagggtaaaagggcaccgattcgaggcaggatctgtatggatcaa
tttatggtcgatgtaagtggtatcgagggagtaaaagttggtgatgaggtagttttaatc
gggagtcaaaatggtctaagccttagtgccgataaacttgctgaacaggcgggaacgatc
aattatgagatagtttccagaataagcaaaagggttgccagaatttataaatga

DBGET integrated database retrieval system