KEGG   Halanaerobium hydrogeniformans: Halsa_0398Help
Entry
Halsa_0398        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_I DUF3784 TMEM18
Motif
Other DBs
NCBI-ProteinID: ADQ13873
UniProt: E4RP48
Position
457761..458168
Genome map
AA seq 135 aa AA seqDB search
MKDIKDPKKLQKKILKTTYLIALLPILSALVAGDMESLLGFVFGLVVATLLLRLKYNNIL
RALNMDMESAEKFIRNRYFAEYGLYFLVLFTAARNPNLNFIAAAVGLFMIKFTVLLLSVK
DLLEDTFQDQFDKYK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattaaagatccaaaaaaactgcagaagaagattttaaaaactacttatttg
atcgctcttttgccgattctttcagccttagtggctggggatatggagtctttacttggt
tttgtttttggtctcgtagttgcaacccttcttttaagattaaaatataataacatatta
agggcacttaacatggatatggaaagtgcggagaagtttattaggaacagatattttgca
gaatatggactttattttcttgttttattcacggcggctagaaatccaaatttaaatttc
atagctgcagcagtgggtttatttatgattaaatttactgttttgcttttgtcggtaaag
gatttattagaggatacttttcaagatcaatttgataagtataaataa

DBGET integrated database retrieval system