KEGG   Halanaerobium hydrogeniformans: Halsa_0416Help
Entry
Halsa_0416        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ13891
UniProt: E4RP66
Position
478972..479859
Genome map
AA seq 295 aa AA seqDB search
MEGPDEHQISIKFLSALIMGLLFAFLLVYVFIPHPREYYPAYEVERENIASAGEVQVLEK
DLEALLAEQEQEHQRFREDFRNRSLQLMESAKESSLAVITSRGLERMDGLREEMLRDLDQ
LQAELEARESSLMREKRRELEANLSSELQAMRREIREKYSDYNQRQIKNNYLRILNLRLA
IDKVAESDSERRPHQEELEQVLAEQQELMSERSQQENMDISARTQTLILEFNQEYYSFRQ
EIRDEHNEILAEEEEEMLAELERIRAEIRAEMEREREDKAARIEALIEESLEKYY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggtcctgatgaacatcaaatatctattaaatttttgtcagctttgatcatgggt
ctgctgtttgcatttctgcttgtttatgtttttatacctcatcctagagaatattatcct
gcctatgaagtggagagagaaaatatcgcttcagccggtgaggttcaggtgctcgaaaaa
gatttggaagctctgctggcagagcaggaacaggaacatcagcgtttccgggaagatttt
agaaataggagccttcagcttatggagtctgcaaaagaaagctctctggcagtaataacc
agccgtggtctggaaagaatggatggtttaagagaagaaatgctaagagatttagatcag
ctgcaggctgagcttgaagccagagaaagcagcttgatgagggaaaaaagacgggaactc
gaagcaaatttaagttcagagctgcaggcaatgaggcgggagattagagaaaaatattcc
gattataatcagcggcagataaaaaataattatctgcggatcttaaatctgcgtctggcc
attgataaggttgcagaaagtgattcagaaagaaggcctcatcaggaagaacttgaacag
gttttagcagaacagcaagagctgatgtcagaacgaagtcaacaggaaaacatggatatt
tctgcccgaacccagaccctgatattagagttcaaccaggaatactattctttcaggcag
gaaattagagatgagcacaatgaaatactggccgaggaagaagaggaaatgctggccgaa
ttagaaaggatcagagcagaaatcagggctgagatggagagggaaagagaagataaggca
gctagaattgaagcattgatcgaagaaagtctggaaaaatattattga

DBGET integrated database retrieval system