KEGG   Halanaerobium hydrogeniformans: Halsa_0431Help
Entry
Halsa_0431        CDS       T01349                                 

Definition
(GenBank) S-layer domain-containing protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLH Porin_4
Motif
Other DBs
NCBI-ProteinID: ADQ13905
UniProt: E4RP80
Position
491839..493647
Genome map
AA seq 602 aa AA seqDB search
MRKLTITIALMLVVALAVPALGAGHGSFSDVPSDHWAYDAINSLVAAGVVEGYPDGEYKG
QESMTRYEMAVMVSRALDNIMAEQEAMAEGLTEGQADDVTAIVESLMERNMPESLTDQQA
EEVADIVEALTFELRAELEVLGADVDALYEDFEALEAKVDAMDVPEDNIEFGVTVETIFE
VADYGDNVKEAGRLWADGDALDLDLAEDFGDWEDANVDEADLPSEKRFWQEIGFDVYGNV
GDADFHLEVDTLVNVFTEEKSAFGYAEDDESNFAMDTALLTVDYADTTFLVGDHVDASIA
RYFVDEEDLQGLAVVKNYLDIDWTFLVAGYGEGDEEVGDTGIILNDIDIYGVTASTDMDF
GTVTGRAYQARLPEDQLNVLGLAVSNVALTDVVTVGGEVAFTDSTVGFNEESDFLFAVDG
EFVVSDELTLTAMFETVGEDFNNWQGDLEEDNNYDLFNVAAAFDLDENNTVSGSYTWVDA
NQDEDKHTVEVMLDNVYGDFTNYASVEYTMDDDFAEDRDVRVIELGTEYALDDVTTLGAA
WVNKDIDDAGTTEINYNYLKGHMNRELSENTVWNVEAKWIDGEYEGDDADSSALTTSLTV
SF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacttacaataacaatagctttaatgctagtcgttgcattagctgttccagca
ttaggtgcaggacatggttcattttctgacgtacctagtgatcactgggcatatgatgct
atcaattcacttgtcgctgctggtgtagtagaaggatatccagatggcgaatacaaaggt
caagaatcaatgacacgttacgaaatggctgttatggttagccgtgcattagataacatc
atggctgaacaagaagcaatggctgaaggtctaactgaaggtcaagctgatgacgtaact
gctatcgttgagtctttaatggaaagaaacatgcctgaaagtcttacagatcaacaggca
gaagaagtagcagatatcgtagaagctcttacttttgaattaagagcagaattagaagta
cttggtgcagatgtagacgctctgtatgaagactttgaagctttagaagctaaagtagac
gctatggacgtaccagaagataacattgaatttggtgtaacagtagaaaccatctttgag
gttgcagattatggtgacaatgtaaaagaagctggtcgcttatgggctgatggagatgca
ttagatcttgatttagctgaggattttggtgattgggaagatgcaaatgtagatgaagca
gaccttccttctgagaagagattctggcaggaaattggattcgatgtatatggtaacgtt
ggcgacgctgacttccacttagaagtagatactttagttaatgtatttaccgaagaaaaa
tctgcttttggatatgcagaagatgatgaaagtaacttcgcaatggatacagctctttta
actgttgactatgctgataccactttcttagttggagatcatgtagatgctagtatagct
cgctacttcgttgatgaagaagatctacaggggttagcagttgttaagaactatctagat
attgactggacattcttagtagccggttacggtgaaggtgacgaagaggtaggagatact
ggtatcatattaaatgatatcgatatttatggtgtaactgcttcaaccgatatggacttc
ggtacagttacaggtagagcttatcaggctagacttcctgaagatcagttaaatgtactt
ggtttagctgtttctaatgtagctttaacagatgttgtaacagttggtggagaagttgca
tttactgatagtacagttggatttaatgaagaaagtgacttcctatttgctgtagacgga
gagttcgtagttagtgatgaattaactcttactgctatgttcgaaactgttggtgaagac
ttcaataactggcaaggcgacttagaagaagataataattatgatctcttcaatgtagct
gcggcatttgacttagatgaaaataatacagttagtggatcatatacatgggtagatgct
aatcaagacgaagataagcacactgttgaagttatgttagataatgtttatggtgatttc
acaaactatgcatctgtagaatatacaatggatgatgattttgcagaagatcgtgatgtt
agagtaatcgaacttggtactgagtatgcattagatgatgtaactactcttggtgcagct
tgggttaacaaagacatagacgatgctggtacaactgaaattaactataactatctgaaa
ggtcatatgaacagagaactttcagaaaataccgtttggaatgtagaagctaaatggatc
gatggagaatatgagggtgatgatgcagattcaagtgctttaactacttctctaacagta
agcttctaa

DBGET integrated database retrieval system