KEGG   Halanaerobium hydrogeniformans: Halsa_0451Help
Entry
Halsa_0451        CDS       T01349                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Halsa_0451
   00052 Galactose metabolism
    Halsa_0451
   00500 Starch and sucrose metabolism
    Halsa_0451
   00520 Amino sugar and nucleotide sugar metabolism
    Halsa_0451
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Halsa_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
520964..521833
Genome map
AA seq 289 aa AA seqDB search
MKVKKAVIPAAGWGTRMLPATKAQPKEMIPIVDKPTIQYIVEEAVEAGIEDILIITSKDK
QSIEDHFDKSTALEKALKEKGKTEMLETVQNISDMITIHSVRQKEQKGLGHAILCAKTFV
GDDPFAVLLGDDIIRSDKAVIKQMIEIYEAKETAVLGCQTVAEEDVSKYGIVKYSSREDD
IYVVEDMVEKPALDEAPSRLGILGRYIITPDIFEILEKTPPGKGGEIQLTDALRTLLEQR
TVYAYDFEGKRYDVGNKFGFLQTTVEFALARDDLGEDFKEYLVELMEEL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaaaaagcagtgattccggcagcaggctggggaacccgtatgctaccggcg
acaaaggcacagccaaaggaaatgattcctatagtagataaacctactattcaatatata
gttgaagaagcggtagaggcaggaatcgaagatattttaatcataacctctaaagacaaa
cagagtattgaagatcattttgataaatcaaccgctttagaaaaagccctaaaagaaaag
ggtaaaacagaaatgttagaaactgtccagaatatttctgatatgatcaccatccattct
gtaagacagaaagaacagaagggtttaggccatgcaatcttatgtgctaagacctttgtt
ggtgatgatccttttgcggttcttttgggggatgatattatcagatcagataaagcggtt
atcaaacagatgatagagatctatgaagccaaagaaacagctgttttaggctgtcagaca
gttgctgaagaagatgtcagcaaatatggaattgttaaatacagcagcagggaagatgat
atttatgtggtagaagatatggtagaaaaaccggctttagatgaagctccatcaaggctt
gggattctgggccgctatattattacacctgatatttttgagatcctagaaaaaacacct
ccaggtaagggaggagaaatccagcttacagatgctttaaggactttgttggagcaaaga
actgtttatgcttatgattttgagggtaagcgatatgatgttggtaataagtttggcttt
ttacagacaacggtagaatttgctctggccagagatgatcttggtgaagattttaaagaa
tatttagtagagttaatggaagaactttaa

DBGET integrated database retrieval system