KEGG   Halanaerobium hydrogeniformans: Halsa_0460Help
Entry
Halsa_0460        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IAT_beta
Motif
Other DBs
NCBI-ProteinID: ADQ13933
UniProt: E4RPP9
Position
530615..532915
Genome map
AA seq 766 aa AA seqDB search
MNFKKITIITITILFIMFTIMTAVSAADVQRSPRFNLRGITGDDFIGQAGILYPFRNKED
SLWYTDFRYRISDDDADEWNLGIGYRYKLDNVDDHIAGVYLFRDKREEYDYDWGMWTIGG
EILTDQWDLRLNAYISDDDVLSAPELDEVVVKDRRLLYQQGAYASMHGLDFEVGKRFTDT
EGIFNDVGIYAKAFRFFESSTETMTGKQLRVDKQFGDRDKTTWKLGLQWRDDNIRGSDTE
ATFAVSIPFGGSSDLEERAGQNEGYNSEDILEARMTELPERDLDIIVGESDALQSNNDEE
NTAFDFSGGVRLGTVWYVTADGDSEGDGSREDPIGIANISGTQLAVAESSNSPGENDVII
LLGDDGSMELNDATINLQSGQKLLSPGGFLTVAADAEGSRKTQFRPEGERAKLENLSIRS
EEVESQRVSGNLIVLADNTTVSGLEINVPGYTGSIIGGSGISGEINVTNNIISGSYSSES
IFEENESVVFKDYNAISILLQQDKNADINIAGNEISNFSKGIEVNSPEIQERGVNTNQID
INISDNKLKDIFAVNFIKGDNYILNEFNANAIGIAVDISSNNSNVNISDNELKGIIAANL
APNINENGILVIAEVNADSNAVAKGIDLDVSSDNSTINIANNELENIFAANLIEGDINAD
VKFNAVAIGIVDINSENSTVNITDNKLENIFAANLIEGDINAPTDLIAVAIGIIDIKSDN
SNVNITDNELKEIIAINAIEGDKNNDTSKKDFVADMTSSIPNIFGN
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaagaaaataacaataattacaataacgatcttatttattatgtttacaatt
atgacagcagtttctgcagcagatgttcagcgttctccaaggtttaacttaagaggaatt
acaggagatgactttatcggtcaggcagggattctttatccttttagaaacaaagaagat
tcgctttggtatactgattttaggtatagaataagtgatgatgatgctgatgagtggaat
ttagggatcggctatagatataagttggataatgttgatgatcatattgcaggtgtatat
cttttcagagataaaagagaggaatatgattatgattggggtatgtggacaattggtgga
gagattttaactgatcagtgggatttaaggctcaacgcctatatctcagatgatgatgtt
ctttcagctcctgaacttgatgaagtagtagtcaaagacagaagactgttatatcaacag
ggagcctatgcgagtatgcatggcttagattttgaagtgggaaaaagatttactgataca
gaaggtatttttaatgatgtaggtatttatgcaaaggcttttagattttttgaaagcagt
acagaaactatgacaggaaaacaactccgagtagataaacagtttggtgatcgagataaa
accacctggaagctcggtttgcagtggcgcgatgataacattagaggtagtgatacagaa
gcaacctttgctgtttcaatcccatttggtggtagttctgatctagaagaaagagcaggc
cagaacgaagggtacaacagtgaagatattttagaagcaaggatgacagaactaccagaa
agagaccttgatataatagttggagaatcagatgcacttcagtcaaataatgatgaagaa
aatactgcctttgatttttcaggtggagtaagactgggaacagtttggtatgttactgct
gatggtgatagtgaaggtgatggttcaagagaagatccgatcggtattgctaatataagt
ggaacacaattggcagttgctgaatccagtaattcccctggagaaaatgatgtgattatt
ttacttggtgatgatggctctatggaattaaatgatgctactataaatcttcagtctgga
caaaaacttctctcacctggaggctttcttactgtagcagcagatgctgaaggcagcagg
aaaacccagtttagaccagagggtgaaagggcaaagctggaaaatttaagtattcggtct
gaagaagtggaatctcagagggtctctggaaatttaattgttttagctgataatactaca
gtttctggattggaaattaatgttccaggatatactggatctattataggtggctcagga
ataagtggagaaataaatgtcaccaataatattatatctggtagttatagcagtgaatca
atttttgaagaaaatgaaagtgttgtatttaaagattataatgctatttcaattttactg
cagcaggacaaaaatgctgatataaatatcgctggaaatgagatttctaatttttcaaaa
ggcattgaagttaattcgccagaaattcaagaaagaggagttaatactaatcaaatagat
attaatatttctgataataaattaaaggatatttttgctgttaactttattaaaggcgat
aattatattcttaatgaattcaatgcaaatgcaataggaatagctgtagatataagtagt
aataattcaaatgtcaatatttctgataatgaattaaaggggataattgcagcgaacctt
gctcctaatattaatgaaaatggtattcttgttattgcagaagtaaatgcagactcaaat
gcagttgcaaaaggtatagatttagatgttagcagtgataattcaactataaatattgct
aataatgaattagagaatatatttgctgctaacttaatagaaggtgatattaatgctgat
gtaaaattcaatgcagttgcaataggtattgtagatataaacagtgaaaattcaactgta
aatattaccgataataaattagagaatatatttgctgctaacttaatagaaggagatatt
aatgctccaacagacttaattgcagtcgcaataggtattatagatataaaaagtgacaat
tcaaatgtaaatattactgataatgaattaaaagaaatcatagctattaatgcaattgaa
ggtgataaaaacaatgatacttctaaaaaggattttgtagcagatatgacatcatctatt
ccaaacatatttggcaattaa

DBGET integrated database retrieval system