KEGG   Halanaerobium hydrogeniformans: Halsa_0490Help
Entry
Halsa_0490        CDS       T01349                                 

Definition
(GenBank) Tripartite ATP-independent periplasmic transporter DctQ component
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctQ
Motif
Other DBs
NCBI-ProteinID: ADQ13963
UniProt: E4RPS9
Position
573338..573874
Genome map
AA seq 178 aa AA seqDB search
MKKFIKNFEEYLSCFFISITVILVIINVIMRYIFNSGIFWTEELATYSFVWSVFIGASAA
YKKRMHIGIDLLTRIVPKKLKELSKMLINFFMVLINGYIAYLSVIFVLESVGRPTPVLGI
SSAFVNASLLVSFSLMTFHAAHFFIKNLLIFLSDEKEKKLRRAEKSVGVKTEIKEEII
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttattaaaaattttgaggaatatttaagttgtttttttatatcaatcacg
gttattctcgtaattattaatgttattatgcgttatatttttaattctggtattttttgg
actgaagagcttgcaacatactcttttgtctggagtgtttttataggggcaagtgctgcc
tataaaaaaagaatgcatattggaattgatttattaactagaatagttccaaaaaaatta
aaagaattaagtaaaatgttgataaacttttttatggtattgataaatggctatatcgca
tatttaagtgtgatttttgttttagaatctgttggaaggccaacaccagttttgggtatc
tcttcagctttcgtaaatgcatctcttttagtgtcattttctttaatgacttttcatgct
gctcacttttttattaagaacttattaatctttctgagtgatgagaaagagaaaaagctg
agaagagcagaaaaaagtgtgggagtaaagactgagattaaagaagaaattatataa

DBGET integrated database retrieval system