KEGG   Halanaerobium hydrogeniformans: Halsa_0493Help
Entry
Halsa_0493        CDS       T01349                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Halsa_0493
Enzymes [BR:has01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     Halsa_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD GDPD_2 PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: ADQ13966
UniProt: E4RPT2
Position
575741..576460
Genome map
AA seq 239 aa AA seqDB search
MAKILNIAHRGASGAYPENSMLSFKKAIEMGCDGLEVDVQLSSDGEVVIFHDKKLDRVTN
GSGLLCQHSFAELKKLEITNNNQDNKFALQRIVSLKELLKMLQENEIFLNIELKNIYIDY
PGLEEKVYQLLKEFEMIDRVVISSFNHYSLQRFAQISKEVGLGIIYLANLIDPIAYAESL
GFKLRSFHPLYSSLDKERVKKIKNAGYDIFTYTVNDKNDITYVSDLEVDGIITDYPDRI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaatattaaatattgctcacaggggagccagtggagcctatccagaaaattcg
atgttgtcttttaaaaaagctatagaaatgggctgtgatggactggaagttgatgtccag
ctcagcagtgatggggaagttgtgatttttcatgataaaaaacttgatagggtgactaat
ggtagtggattactctgtcagcacagttttgccgagttaaaaaaactagaaattactaat
aataatcaagataataaatttgctctgcagcgtatagttagtttaaaagaactgctaaaa
atgctgcaggaaaatgagatatttttaaacatagaacttaagaatatatacatagattac
ccgggcttagaagaaaaagtttatcaacttttaaaagaatttgaaatgatagatagggta
gttatttcatctttcaatcattattctctgcagagatttgcccagataagcaaagaggtt
ggtttaggaattatatatttggctaatcttatagatccaattgcttatgcagaatcttta
ggctttaaacttagatcatttcatcctctctacagcagcttagataaagagagggtaaag
aaaattaaaaatgcaggttatgatatttttacttataccgttaatgataaaaatgatatt
acatatgtctctgatttagaagtagatggaataatcactgattatccagacagaatataa

DBGET integrated database retrieval system