KEGG   Halanaerobium hydrogeniformans: Halsa_0497Help
Entry
Halsa_0497        CDS       T01349                                 

Definition
(GenBank) response regulator receiver and SARP domain protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: ADQ13970
UniProt: E4RPT6
Position
579824..580885
Genome map
AA seq 353 aa AA seqDB search
MNSVVYMGDRENDDILNVLSSDTKNLEISDVFYSAEILLDFLREDEEKIDIIFLDIDKNE
DDIFTLVEKLLKLSPEFNFVFMISKNHDFLEILQNKELFYLLKPISAADLKVVIEKVRKE
KQSVGSLTELYIETQGDIRIYDVDRNKLNINWPDSKTKELFAFLLHHKGEFVSRDKIIEK
LWGANDNKNFRILFFSTLLKLRKIFSQYGFDNLIEANLTAYRISLKRIEVDFIKIEILLK
KSITNKYRVYKLLNLLKGSYLAADNFDWCKEYRKEFEKRIKKELNHAAEYFMSVGQNTIT
KNILTTLINIGVVDESVYDKLINIYKRECNNEKAEQLLKELDNISKEELASII
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgttgtatatatgggtgatcgtgaaaatgatgatattttaaatgtattaagt
tctgacacaaaaaaccttgagatctcagatgttttttattctgcagaaatcctccttgat
tttttaagagaagatgaagaaaaaatagatattatctttctggatatagataagaatgaa
gatgatatttttactttggttgaaaaattattaaaattatctcctgaatttaattttgtc
tttatgatttctaaaaatcatgattttttagaaatattacaaaacaaagagttgttctat
cttttaaagcctatttctgctgctgatcttaaggtagtgatcgaaaaggttagaaaagaa
aagcaaagtgttggttctttaactgaattatatatagaaactcagggagatataagaatc
tatgatgtcgatagaaataagcttaatataaattggcctgattcaaaaacaaaagaatta
ttcgcttttttacttcatcataaaggtgaatttgtaagtagagataaaattattgaaaaa
ctctggggagcaaacgataacaaaaactttagaatattatttttcagcaccctgttaaag
ctccgaaaaattttctctcaatatggatttgataatcttatagaagcaaatttgacagct
tatagaatttcattaaaaagaattgaagtagattttatcaaaattgagattcttttaaaa
aaatctatcacaaacaaatatagagtttataagttgttgaatttattaaaaggtagttat
ttagctgctgataattttgactggtgtaaagaatacagaaaagaatttgaaaaaagaata
aaaaaagaattaaatcatgccgcagaatattttatgtcagtaggtcagaatacaattaca
aaaaatatcttaactacacttataaatataggagtagtggatgaatctgtttatgataaa
cttataaacatctataaacgagaatgtaataatgagaaagctgaacaacttttaaaagaa
ttagataatatttcaaaagaagaactagcttcaataatttaa

DBGET integrated database retrieval system