KEGG   Halanaerobium hydrogeniformans: Halsa_0499Help
Entry
Halsa_0499        CDS       T01349                                 

Definition
(GenBank) glutaredoxin 3
  KO
K03387  alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]
Organism
has  Halanaerobium hydrogeniformans
Brite
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.4  With a disulfide as acceptor
    1.6.4.-  
     Halsa_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO NAD_binding_8 Thi4 DUF836 Thioredoxin_3 K_oxygenase Lycopene_cycl GST_N_3 AlaDh_PNT_C FAD_binding_3 SH3BGR FMO-like GST_N_2 3HCDH_N Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ADQ13972
UniProt: E4RPT8
Position
582947..584134
Genome map
AA seq 395 aa AA seqDB search
MNKSDIEIYTKQWCPYCRRAKAMLRSLELEYIDYDITDDKELYEEMVERSGHKTIPQIFI
DGENIGGYDALIEKISSGELDYLIDFEIPECEGNVWDLTVIGAGPAGMTAAIYAVRKGLK
VLLVARDIGGQVLETDIIDNYPPEYNVSGPDLMQDFLDHLRNYKIDTLFGEEVIEIKVKE
AGHQIIVKSGKKINTDAVIISAGTKKRHLGIPGESQLKDKGVSYCATCDGFLYEGQPVAV
VGGGNSGLEAALDMARIAEKVYLLVRSERLSGDQTLQDKVMNSDKIEICWSYQAIKINGD
TKVESLLIKNLNTGKQRKLNVDAVFIEIGLLPNSGFICEDLKINDYNEVMIDQNNQTSVE
GIYAAGDITDIKDKQIIVAAAEGAKAALRVNEYLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtcagatattgaaatctatacaaaacagtggtgcccttactgtagaagagca
aaagcaatgttgagaagtctggagttagaatatatcgattatgatatcacagatgataaa
gaattatatgaagaaatggtagaaagaagtggccataaaactattccccaaatttttata
gatggtgaaaacatcggtggttatgatgctttgattgaaaaaataagttctggtgaactg
gattatttaatcgattttgaaataccggaatgtgaaggcaatgtctgggatctaacagtg
attggtgctggcccggctggaatgacagcagcaatttatgcggtaagaaagggattgaag
gtgcttttagttgccagggatataggaggacaggttctagaaacagatataatagataat
tatccacctgaatataatgttagcggacctgatctgatgcaggattttttagatcacctg
agaaactataagatcgataccctgtttggagaagaagttattgagatcaaagttaaagaa
gctggccatcagataatcgtcaaaagtggtaaaaaaatcaatacagatgcagtcataatt
tctgccggtaccaaaaaacgtcaccttggtatccctggtgaaagccaattaaaggacaaa
ggtgtaagttactgtgctacctgtgatggatttttatatgaaggccagccagttgcagta
gttggtggaggtaattccggtcttgaagcagcccttgatatggccagaatagcagagaag
gtttatcttctggtcagaagtgagcggctttctggtgatcaaactctacaggataaggta
atgaattcggataaaattgagatctgctggtcctatcaggcgattaagattaatggtgat
actaaggtagagtcacttttaattaaaaacctaaataccggcaaacagagaaagcttaat
gttgatgcagtatttatagaaatcggattgcttccaaacagcggttttatctgtgaagat
cttaaaataaatgattataatgaagtaatgatagatcaaaacaatcaaacaagtgtcgaa
gggatttatgcagctggagatataactgatataaaggacaaacagattatagtagcagca
gcagaaggtgccaaagcagctttaagagtaaatgagtatttgagctaa

DBGET integrated database retrieval system