KEGG   Halanaerobium hydrogeniformans: Halsa_0510Help
Entry
Halsa_0510        CDS       T01349                                 

Definition
(GenBank) glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00260  Glycine, serine and threonine metabolism
has00561  Glycerolipid metabolism
has00630  Glyoxylate and dicarboxylate metabolism
has01100  Metabolic pathways
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Halsa_0510
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halsa_0510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_0510
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Halsa_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ13980
UniProt: E4RPF7
Position
597890..599038
Genome map
AA seq 382 aa AA seqDB search
MKILVAPDSFKGSLTALEAAENIKKGIKNFDAQIEVDLLPLADGGEGTVQSLVDAADGEI
IKKKVTGPLGEKVEAFYGLLAEQNTAVIEMAAASGLPLLAEAERNPLKTTTYGTGELIAA
ALDKGIEKIIIGIGGSATNDAGVGMAQALGAKITDKNGRQLAFGGESLAEIDNIDLSSLD
PRLKEVEILAACDVDNPLYGENGAAYVYAPQKGADQKMVEILDNNLRKFNQVVMEELNIN
SNHIAGAGSAGGLGAGLAVFLGAELKAGIEIILNSLDFESRLEGVDFLITGEGRLDGQSI
NGKVPTGAGRRAQKLQIPVIAVAGSLGEGVEKVLKHGIDAYFCIIDRPADLEAIIKDSPK
LLASLSEQLMRTLALSVPGTKR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgttgccccggattcttttaaaggctcattaacagctttagaagcagca
gaaaatatcaaaaaaggcatcaaaaactttgatgctcagatagaggttgatcttttaccc
ctggcagatggaggagaaggaactgttcaatccctggtagatgctgctgatggtgaaata
atcaaaaagaaagttacaggccctcttggtgaaaaagtagaggctttttatggtttgctt
gctgagcaaaatactgctgttatagagatggcagctgcttctggacttccgctgcttgct
gaagctgagagaaatcctcttaaaactaccacatatggaactggagagttgattgcagca
gctttagataaaggaattgaaaaaataattatcggaattggaggtagtgctaccaatgat
gctggagtggggatggcccaggctttaggtgctaaaattactgataaaaatggcaggcaa
ttggcttttggaggagaaagtctggctgaaatcgataatatagatttaagcagcttagat
cccagattaaaagaggtagaaattttagcagcctgtgatgtagataaccctctttatggc
gaaaatggtgctgcctatgtatatgcaccgcaaaaaggtgctgatcaaaagatggtagaa
attcttgataataatttacgaaaatttaatcaggttgttatggaagaactcaatataaac
agcaatcatattgctggagctggttcagccggaggacttggagctggcttggcagttttt
ttaggtgctgaattaaaggctggaattgagattatattaaatagtcttgattttgagtcc
agactggaaggtgtagattttttgataaccggtgaaggaaggttggatgggcagagcatt
aatggtaaggtgccaactggagctggcaggcgagctcaaaaattacagatacctgttatc
gctgtagcaggcagcctgggtgaaggagtagaaaaagttttgaaacatggtattgacgct
tatttttgtattatagatagaccggctgatttagaggcgataataaaagatagcccaaaa
ttgctggcaagtttaagtgaacagctaatgagaactttagccctatctgtaccaggtact
aaacgctaa

DBGET integrated database retrieval system