KEGG   Halanaerobium hydrogeniformans: Halsa_0727Help
Entry
Halsa_0727        CDS       T01349                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00030  Pentose phosphate pathway
has01100  Metabolic pathways
has01120  Microbial metabolism in diverse environments
has01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Halsa_0727
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Halsa_0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADQ14177
UniProt: E4RMW0
Position
831379..833184
Genome map
AA seq 601 aa AA seqDB search
MGKIYEYQVLRVNLSDGEISRETIAGENVKKFLGGRGLASKMLYDEIDPKVDPLSPENKL
IYASGLLTGTAASTGGRYMVITKGPLTGTIASSNSGGFFGAEMRFSGNDIIVFEGKAEKP
VYLSLKGDKAELKDASHLWGKGVYDTTDMLIEEFGDEKARVSCIGPGGEKLVKFASIMNE
KDRAAGRTGVGAVMGSKNLKAIVVKADEKQVEYFKDEMMEVVKKQTKTLKEDGVTGEGLP
ALGTKVLDNIINSHGAYPRNNFQYGTFADVEEVSGEALVEKGYLQGNKGCYGCPIRCGRH
TKLPNGQEGEGPEYETGWAFGADCGVNDLNAIVQANFLCNDLGLDTISAGATIAAAMELY
EKGYIDKDELENGPELKFGSSESVIYYTRQMAYREGFGDQMAEGSYRLAEAKGNAELSMS
VKKQELPAYDPRGIQGQGLNYATSNRGGCHVRGYMVSPEVLGVPEKLDPLELKGKPEWVK
IFQDLTAVIDSLGMCLFTSFALGLEDYTEIANAGTEFDFTPEEMLENGERIWNLERQFNL
EAGITPDQDKLPKRFDEPLPDGTFRGSAAKYREILPEYYEIRGWQEDGWISDEKLSEMGL
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatttatgaatatcaggtattaagggtaaatttaagtgatggagaaatttca
cgcgaaacaattgctggtgaaaatgttaaaaagtttttaggtgggagaggtctcgcttct
aaaatgctttatgatgaaattgatccaaaggttgatcctttaagccctgaaaacaagctt
atttatgcttcaggtcttctaacaggtactgcagcttctacgggaggacgctatatggta
atcaccaagggtcctttaacaggtactattgcaagtagtaactcaggtggattcttcggt
gctgaaatgagatttagcggtaatgatataattgtatttgaaggtaaagcagaaaaacct
gtctatctatctctaaaaggagataaggctgaactcaaagatgcttcacatctgtggggt
aaaggtgtttatgatactacagatatgttaattgaagaatttggtgatgaaaaagcaaga
gtaagctgtatcggtcctggtggagaaaaactggttaaatttgcttcaataatgaatgaa
aaagatagagcagcaggtagaaccggtgttggagcagttatgggttctaaaaacttaaaa
gccatagttgttaaagctgatgaaaaacaggtagagtattttaaagatgagatgatggaa
gtggttaaaaagcagactaaaacattaaaagaagatggagttacaggagaaggtcttcct
gccctgggtactaaggtgcttgataatattatcaactcacatggagcatatccaagaaat
aacttccagtatggtacctttgcagatgttgaagaggtatcaggagaagctttagtagaa
aaaggctatctacagggtaataaaggatgttatggttgtcctatccgctgtggtagacat
accaaacttccaaatggccaggaaggtgaaggtcctgaatacgaaactggttgggctttt
ggtgctgactgtggtgttaatgatttaaatgctatagttcaggcaaacttcctctgtaat
gatttaggtttggatacaatatctgctggtgcaaccattgcagctgcaatggaattatat
gaaaaaggttatatagataaagatgaactggaaaatggtccagaacttaaatttggttct
tcagaatcagttatttattatacaagacagatggcttatcgtgaaggttttggcgaccag
atggctgaaggttcatatagattagcagaagctaaaggtaatgcagaactttctatgagt
gttaaaaaacaggaattacctgcctatgatcctcgcggaattcaaggccagggtttaaat
tatgctacctctaatcgtggtggatgtcatgtaagaggatatatggtttctccagaggta
ttaggagtaccagaaaaacttgatccgcttgaattaaaaggaaagccagagtgggttaaa
atattccaggatctaacagcagtaattgattcacttggaatgtgcctctttacttctttt
gcccttggtttagaagattatacagaaatagctaatgccggaacagagtttgattttaca
ccagaagaaatgctggaaaatggagaaagaatctggaacctggagcgtcagtttaacctt
gaagcaggtattacacctgatcaggataaacttcctaagcgctttgatgaaccacttcca
gatggaacctttagaggttctgcagctaaatatagagaaattctgcccgagtattatgaa
attcgcggctggcaggaagatggctggattagtgacgaaaaattaagtgagatgggattg
aaataa

DBGET integrated database retrieval system