KEGG   Halanaerobium hydrogeniformans: Halsa_0834Help
Entry
Halsa_0834        CDS       T01349                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_0834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0834
   00052 Galactose metabolism
    Halsa_0834
   00500 Starch and sucrose metabolism
    Halsa_0834
   00520 Amino sugar and nucleotide sugar metabolism
    Halsa_0834
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halsa_0834
   00524 Butirosin and neomycin biosynthesis
    Halsa_0834
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halsa_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
954145..955119
Genome map
AA seq 324 aa AA seqDB search
MKEYYLGLDLGGTKILTGLADKNGKILARSRKDTEAKYGEEKIIANMVESIEDVLAKTEL
KAEDIKCLGIGSPGPLDAKKGIIIENSNLPWKNVAIVDRIEKEVGIKTLLKNDANAAALG
EKWFGAGRKVKNLVYITISTGVGGGAIINQELFTGVNDNACEIGHTVIDPDGPLCGCGNH
GCLEAFASGTAIGRMAQEATAEGKSKKMLDLADNIIEDVDAVICAQAAYQGDQIAKDIFA
IAGFYLGIGLANLINIFNTEMIILGGGVMKASDLFLDKALELMRENALAGPLEIVEIREA
ELGSDIGLMGAIAVAMEDRLIKNG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatattatcttggtctagatttaggtggcacaaaaatattaaccggtttagct
gataaaaatggcaaaattttagcccgttcacgtaaagatactgaggcaaaatatggtgaa
gaaaaaattatagccaatatggttgagagtatagaagatgttttagcaaaaacagaactt
aaagcagaagatatcaaatgtcttggcatcggaagccctggtcctttagatgctaaaaaa
ggaataattatagagaattctaatttgccctggaaaaatgttgctattgttgacagaatt
gaaaaagaagttggaattaaaactttgttaaaaaatgatgctaatgctgcagctttaggt
gaaaaatggtttggagcaggtagaaaagtaaaaaatttagtttatattaccatttcaacc
ggtgttggtggaggagctataatcaatcaggaattatttactggagttaatgataatgcc
tgtgaaatcggtcataccgtaattgatccagatgggcctctctgtggatgtggcaatcat
ggctgtttagaagcttttgcttctggaactgcgataggccggatggctcaggaggcaaca
gctgagggtaaaagcaaaaaaatgcttgatctggcagataatattatagaagatgttgat
gctgttatctgtgctcaagctgcttatcagggtgatcagatagcaaaagacatctttgct
atagcaggattttatcttgggattggcctggctaatttgataaatatctttaatacagaa
atgataatcttaggaggcggagttatgaaggcatctgatctttttttagataaagcttta
gagttgatgcgggaaaatgccctggcaggaccactagaaatcgttgagataagggaagct
gaacttggttctgatattggtttaatgggagctattgcagttgcaatggaagacaggttg
ataaaaaatggctga

DBGET integrated database retrieval system