KEGG   Halanaerobium hydrogeniformans: Halsa_0844Help
Entry
Halsa_0844        CDS       T01349                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00051  Fructose and mannose metabolism
has00562  Inositol phosphate metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
has01230  Biosynthesis of amino acids
Module
has_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
has_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0844
   00051 Fructose and mannose metabolism
    Halsa_0844
   00562 Inositol phosphate metabolism
    Halsa_0844
Enzymes [BR:has01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halsa_0844
Exosome [BR:has04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halsa_0844
  Exosomal proteins of bladder cancer cells
   Halsa_0844
  Exosomal proteins of melanoma cells
   Halsa_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADQ14291
UniProt: E4RN74
Position
964804..965568
Genome map
AA seq 254 aa AA seqDB search
MRKPFICGNWKMNKNVDQAKDMIEKLKAKVADVTEVEMGICPTALALTAFKEAAAGSDIV
TGAQNIYWEESGAYTGEISAKMLADSEIEYTIIGHSERREIFGESDFEVNKKVHAALENG
VKAIVCVGETLEERKAEKIEAKVNFQVDAALAGLSEEEIAEVVIAYEPIWAIGTGETASA
EEANRVIGIIRDHIRESYPQAAEKIRIQYGGSVKPHNVEEIMAQEEIDGALVGGASLKAE
SFSEIILKTEEIYK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccatttatttgtggtaactggaaaatgaataaaaatgttgatcaggctaaa
gatatgatagaaaaactaaaagctaaagttgcagatgtaacagaggtcgaaatgggaatc
tgcccaactgctcttgctttaactgcatttaaagaagctgcagcaggtagtgatattgta
actggagcacaaaatatttactgggaagaatccggtgcttatactggagaaatttctgcg
aaaatgttagctgatagtgagatagaatatacaatcatcggtcactcagaacgcagagaa
atattcggtgaaagcgattttgaagtaaataaaaaggttcatgctgcacttgaaaatgga
gtaaaagcaattgtttgtgtaggtgaaactttagaagaaagaaaagcagaaaaaatagaa
gccaaggttaactttcaggtagatgctgctttagctggattaagcgaagaagaaattgcc
gaggtagtaattgcctatgaacctatctgggcgattggtacaggagaaactgcttctgca
gaagaagcaaatagagtgatcggcataattagagatcacattagagaaagttatcctcaa
gcagcagaaaaaattcgtattcagtatggtggtagtgttaaaccacataatgttgaagaa
atcatggctcaggaagaaattgatggtgctttagttggtggagccagccttaaagctgaa
tctttttctgagataatattaaaaacagaagaaatatataaataa

DBGET integrated database retrieval system