KEGG   Halanaerobium hydrogeniformans: Halsa_0844Help
Entry
Halsa_0844        CDS       T01349                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_0844
   01230 Biosynthesis of amino acids
    Halsa_0844
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0844
   00051 Fructose and mannose metabolism
    Halsa_0844
   00562 Inositol phosphate metabolism
    Halsa_0844
Enzymes [BR:has01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halsa_0844
Exosome [BR:has04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halsa_0844
  Exosomal proteins of bladder cancer cells
   Halsa_0844
  Exosomal proteins of melanoma cells
   Halsa_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
964804..965568
Genome map
AA seq 254 aa AA seqDB search
MRKPFICGNWKMNKNVDQAKDMIEKLKAKVADVTEVEMGICPTALALTAFKEAAAGSDIV
TGAQNIYWEESGAYTGEISAKMLADSEIEYTIIGHSERREIFGESDFEVNKKVHAALENG
VKAIVCVGETLEERKAEKIEAKVNFQVDAALAGLSEEEIAEVVIAYEPIWAIGTGETASA
EEANRVIGIIRDHIRESYPQAAEKIRIQYGGSVKPHNVEEIMAQEEIDGALVGGASLKAE
SFSEIILKTEEIYK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccatttatttgtggtaactggaaaatgaataaaaatgttgatcaggctaaa
gatatgatagaaaaactaaaagctaaagttgcagatgtaacagaggtcgaaatgggaatc
tgcccaactgctcttgctttaactgcatttaaagaagctgcagcaggtagtgatattgta
actggagcacaaaatatttactgggaagaatccggtgcttatactggagaaatttctgcg
aaaatgttagctgatagtgagatagaatatacaatcatcggtcactcagaacgcagagaa
atattcggtgaaagcgattttgaagtaaataaaaaggttcatgctgcacttgaaaatgga
gtaaaagcaattgtttgtgtaggtgaaactttagaagaaagaaaagcagaaaaaatagaa
gccaaggttaactttcaggtagatgctgctttagctggattaagcgaagaagaaattgcc
gaggtagtaattgcctatgaacctatctgggcgattggtacaggagaaactgcttctgca
gaagaagcaaatagagtgatcggcataattagagatcacattagagaaagttatcctcaa
gcagcagaaaaaattcgtattcagtatggtggtagtgttaaaccacataatgttgaagaa
atcatggctcaggaagaaattgatggtgctttagttggtggagccagccttaaagctgaa
tctttttctgagataatattaaaaacagaagaaatatataaataa

DBGET integrated database retrieval system