KEGG   Halanaerobium hydrogeniformans: Halsa_0955Help
Entry
Halsa_0955        CDS       T01349                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:has00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089472..1090335
Genome map
AA seq 287 aa AA seqDB search
MGKSKNVIITNRGELDYSRKTLIMGILNLTPDSFSDGGEYNDLKGAVARAVEMEKAGADI
IDIGAESSRPYSERICEEVEKKRLLPILDEILKVTKIPISIDTYKSSVARAALKRGASMI
NDISGLRFDKKMAATAAEFNAPVIIMHIQGKPENMQDDPSYKNLIFEIKEYLWQGIELAI
EAGISEEQIVIDPGIGFGKKQIHNLQILNRLESFKELNYPILIGTSRKSLIKFINEDETD
NRLFGTAATVSASILKGANIVRVHDVKEIKKVALMSDALKWEGKHEK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagtaaaaatgttattatcacaaatcggggagaacttgattatagcagaaaa
acattgattatggggattcttaatctaacacctgattctttttctgatggaggagaatat
aatgatcttaaaggagcagtagcaagggctgtagaaatggaaaaagcaggtgcagatatc
attgatattggtgcagaatccagccgtccttactcagaaaggatctgtgaagaagtagag
aagaagagattactgcctattttagatgaaatattaaaagttactaaaattcctatttca
atcgatacttataaaagctctgtggctcgtgctgcactcaaacgaggtgcttcgatgatc
aatgatattagtgggctccgttttgataaaaaaatggctgccactgctgcggaattcaat
gctccagttattataatgcacattcagggaaaaccagaaaatatgcaggatgatcccagt
tataaaaatctgattttcgagatcaaagaatatctctggcagggcatagagctggctata
gaagcagggataagtgaagaacaaattgttattgaccccggaataggttttggcaaaaaa
cagattcataacctgcagattttaaataggctggaaagttttaaagagctaaattatcct
attttaatcggtacttcaagaaaatctttaattaaatttataaatgaggatgaaacagat
aacagactttttggaacagctgcaactgtatcagcttcgattcttaaaggagcaaatatt
gttagagttcatgatgttaaagaaattaaaaaggttgccttaatgtcagatgctcttaaa
tgggagggcaaacatgaaaaatag

DBGET integrated database retrieval system