KEGG   Halanaerobium hydrogeniformans: Halsa_1237Help
Entry
Halsa_1237        CDS       T01349                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
has  Halanaerobium hydrogeniformans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halsa_1237
   00670 One carbon pool by folate
    Halsa_1237
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Halsa_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1397429..1397926
Genome map
AA seq 165 aa AA seqDB search
MSLSIIAAMDQNQLIGQNGKLPWKLPADLRYFKQTTMGSAIIMGRKTFESIGSPLAGRKN
IILSKNKNYSAEGCEIIHSKKEILNRFLVQKKEAFIIGGLKIFQLFLPYCDKLYLTIIEH
EFSGDTYFPEIDFDNWIKIQVKKGVTDCENPYEYYHNIYLRKKGK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatcaattatcgcagcaatggatcagaatcaattgatcggtcaaaacgggaaa
cttccctggaaactacccgcagatttaaggtattttaagcagactactatgggatcagct
attataatggggagaaagacttttgaatctattggatctcctttagcaggtagaaaaaac
atcattttatctaaaaataaaaattattctgcagagggctgtgagataattcattccaaa
aaagaaattctaaatagatttttagtgcagaaaaaagaagcttttataattggaggtcta
aaaatttttcaactttttttgccttattgtgataaattatatttaaccattatagaacac
gaattttccggagatacttattttccagagatagattttgataattggattaaaatacaa
gtaaagaaaggtgttactgattgtgaaaacccatatgaatattatcataatatttatcta
aggaaaaaaggtaaatag

DBGET integrated database retrieval system