KEGG   Halanaerobium hydrogeniformans: Halsa_1237Help
Entry
Halsa_1237        CDS       T01349                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
has  Halanaerobium hydrogeniformans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:has00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:has00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1397429..1397926
Genome map
AA seq 165 aa AA seqDB search
MSLSIIAAMDQNQLIGQNGKLPWKLPADLRYFKQTTMGSAIIMGRKTFESIGSPLAGRKN
IILSKNKNYSAEGCEIIHSKKEILNRFLVQKKEAFIIGGLKIFQLFLPYCDKLYLTIIEH
EFSGDTYFPEIDFDNWIKIQVKKGVTDCENPYEYYHNIYLRKKGK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatcaattatcgcagcaatggatcagaatcaattgatcggtcaaaacgggaaa
cttccctggaaactacccgcagatttaaggtattttaagcagactactatgggatcagct
attataatggggagaaagacttttgaatctattggatctcctttagcaggtagaaaaaac
atcattttatctaaaaataaaaattattctgcagagggctgtgagataattcattccaaa
aaagaaattctaaatagatttttagtgcagaaaaaagaagcttttataattggaggtcta
aaaatttttcaactttttttgccttattgtgataaattatatttaaccattatagaacac
gaattttccggagatacttattttccagagatagattttgataattggattaaaatacaa
gtaaagaaaggtgttactgattgtgaaaacccatatgaatattatcataatatttatcta
aggaaaaaaggtaaatag

DBGET integrated database retrieval system