KEGG   Halanaerobium hydrogeniformans: Halsa_1239Help
Entry
Halsa_1239        CDS       T01349                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00260  Glycine, serine and threonine metabolism
has00400  Phenylalanine, tyrosine and tryptophan biosynthesis
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01130  Biosynthesis of antibiotics
has01230  Biosynthesis of amino acids
Module
has_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_1239
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halsa_1239
Enzymes [BR:has01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halsa_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ14667
UniProt: E4RKF8
Position
1398887..1400056
Genome map
AA seq 389 aa AA seqDB search
MKEKSREEQRSGFFGDFGGRIVPEDLASALEELKEGFEEIKDNKEFRDELAILFKDYVGK
PSPLYFAKNLTKEVGGAKIYLKREDLNHTGAHKINNCIGQALLARKMGKKRIIAETGAGQ
HGVATATACALFDMDCEIFMGEVDTKRQELNVFRMELLGANVNAVSAGDGTLKDAVDEAL
KDFVTNVDTTFYMLGSAVGPDPYPTMVKEFQSIIGKEARMQILEKENKLPDYIVACVGGG
SNAIGLFAPFVDDKEVNILGIEPGGKGDKPGQNAAPLTFGKPGELHGFKSYVLYDENDEI
SHTHSIAAGLDYPGVGPEHGYLKDSGRAKYTTASDQEALDAFHLLSEKEGIIPALESAHA
VAGGMKIAKDLNEDQIVIINLSGRGDKEM
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaagagtagagaagagcaaagaagtggtttttttggtgattttggaggcaga
atagttccagaagatttagcttctgctttagaggaattaaaagaggggtttgaagaaatc
aaagacaataaagaatttcgggatgaacttgctattctttttaaagattatgtaggtaaa
cccagccctttatattttgctaaaaatctcactaaagaagtcggaggagcaaagatatac
ttaaaaagagaggatttaaaccacacaggtgctcataaaattaataactgtattggtcag
gcgttactggccagaaaaatgggcaaaaaaagaattattgctgaaactggtgctggtcaa
catggtgtagcaacagcaactgcctgtgcactttttgatatggattgtgagatttttatg
ggagaagttgatacaaaacgccaggaattaaatgtttttagaatggaattgcttggtgct
aatgttaatgctgtttctgcaggagatggaactttaaaagatgcagttgatgaagcatta
aaagattttgttacaaatgttgatactactttttatatgctaggttctgctgttggacct
gatccttatccaactatggttaaagaattccagtccataattggtaaagaagccagaatg
cagattttagaaaaagaaaataaattacctgattacatagttgcctgtgttggtggagga
agtaatgcaattggattatttgctccttttgtagatgataaagaagttaatatattaggt
attgagccaggtggtaagggtgataaacccggacaaaacgcagctccattaacttttgga
aaacctggagaattacatggatttaaaagttatgttctttatgatgaaaatgatgagatt
tctcatactcattctattgcagcaggacttgattatcccggtgtaggaccagagcacggt
tatttaaaagatagtggtagagctaaatatacaaccgcttctgaccaggaagcattagac
gctttccatcttttatccgaaaaagagggtattatacccgctttagaaagcgctcatgct
gttgcaggaggaatgaaaatagctaaagatctaaatgaagatcaaattgtaataatcaat
ctctcaggtaggggagataaagagatgtag

DBGET integrated database retrieval system